EH117788

Overview
NameEH117788
Unique NameEH117788
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length211
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2178 contig Csv1_Contig2178:412..622. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: MPK3_ARATH (Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 9.670e-27
Identity = 56/62 (90.32%), Postives = 60/62 (96.77%), Query Frame = -1
Query:   17 QFTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 202
            QF+DVYI+ ELMDTDL+QIIRSNQSLSEEHCQYFLYQLLRGLKYIHSAN+IHRDLKPSNL L
Sbjct:  111 QFSDVYISTELMDTDLHQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANIIHRDLKPSNLLL 172          
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: MPK6_ARATH (Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.824e-25
Identity = 54/61 (88.52%), Postives = 58/61 (95.08%), Query Frame = -1
Query:   17 FTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 199
            F DVYIA ELMDTDL+QIIRSNQ+LSEEHCQYFLYQ+LRGLKYIHSANV+HRDLKPSNL L
Sbjct:  137 FNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLL 197          
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: MPK1_ORYSJ (Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.824e-25
Identity = 54/61 (88.52%), Postives = 58/61 (95.08%), Query Frame = -1
Query:   17 FTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 199
            F DVYIA ELMDTDL+QIIRSNQ+LSEEHCQYFLYQ+LRGLKYIHSANV+HRDLKPSNL L
Sbjct:  141 FNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLL 201          
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: MMK1_MEDSA (Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.824e-25
Identity = 54/61 (88.52%), Postives = 58/61 (95.08%), Query Frame = -1
Query:   17 FTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 199
            F DVYIA ELMDTDL+QIIRSNQ+LSEEHCQYFLYQ+LRGLKYIHSANV+HRDLKPSNL L
Sbjct:  129 FNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLL 189          
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: MAPK_PEA (Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.824e-25
Identity = 54/61 (88.52%), Postives = 58/61 (95.08%), Query Frame = -1
Query:   17 FTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 199
            F DVYIA ELMDTDL+QIIRSNQ+LSEEHCQYFLYQ+LRGLKYIHSANV+HRDLKPSNL L
Sbjct:  136 FNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLL 196          
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: NTF4_TOBAC (Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.382e-25
Identity = 54/61 (88.52%), Postives = 57/61 (93.44%), Query Frame = -1
Query:   17 FTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 199
            F DVYIA ELMDTDL+QIIRSNQ LSEEHCQYFLYQ+LRGLKYIHSANV+HRDLKPSNL L
Sbjct:  134 FNDVYIAYELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLL 194          
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: MPK5_ORYSJ (Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.111e-25
Identity = 54/61 (88.52%), Postives = 56/61 (91.80%), Query Frame = -1
Query:   17 FTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 199
            F DVYIA ELMDTDL+ IIRSNQ LSEEHCQYFLYQ+LRGLKYIHSANVIHRDLKPSNL L
Sbjct:  110 FNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLL 170          
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: MPK5_ORYSI (Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 3.111e-25
Identity = 54/61 (88.52%), Postives = 56/61 (91.80%), Query Frame = -1
Query:   17 FTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 199
            F DVYIA ELMDTDL+ IIRSNQ LSEEHCQYFLYQ+LRGLKYIHSANVIHRDLKPSNL L
Sbjct:  110 FNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLL 170          
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: MPK5_ARATH (Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 2.633e-24
Identity = 51/61 (83.61%), Postives = 57/61 (93.44%), Query Frame = -1
Query:   17 FTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 199
            F DVYI  ELMDTDL+QIIRSNQSL+++HCQYFLYQ+LRGLKYIHSANV+HRDLKPSNL L
Sbjct:  117 FVDVYIVFELMDTDLHQIIRSNQSLNDDHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLL 177          
BLAST of EH117788 vs. ExPASy Swiss-Prot
Match: MPK6_ORYSJ (Mitogen-activated protein kinase 6 OS=Oryza sativa subsp. japonica GN=MPK6 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.439e-24
Identity = 50/61 (81.97%), Postives = 57/61 (93.44%), Query Frame = -1
Query:   17 FTDVYIAAELMDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLSL 199
            F DVYI +ELMDTDL+QIIRSNQ L+++HCQYFLYQLLRGLKY+HSANV+HRDLKPSNL L
Sbjct:  117 FNDVYIVSELMDTDLHQIIRSNQPLTDDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLFL 177          
The following BLAST results are available for this feature:
BLAST of EH117788 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 190
Match NameE-valueIdentityDescription
MPK3_ARATH9.670e-2790.32Mitogen-activated protein kinase 3 OS=Arabidopsis ... [more]
MPK6_ARATH1.824e-2588.52Mitogen-activated protein kinase 6 OS=Arabidopsis ... [more]
MPK1_ORYSJ1.824e-2588.52Mitogen-activated protein kinase 1 OS=Oryza sativa... [more]
MMK1_MEDSA1.824e-2588.52Mitogen-activated protein kinase homolog MMK1 OS=M... [more]
MAPK_PEA1.824e-2588.52Mitogen-activated protein kinase homolog D5 OS=Pis... [more]
NTF4_TOBAC2.382e-2588.52Mitogen-activated protein kinase homolog NTF4 OS=N... [more]
MPK5_ORYSJ3.111e-2588.52Mitogen-activated protein kinase 5 OS=Oryza sativa... [more]
MPK5_ORYSI3.111e-2588.52Mitogen-activated protein kinase 5 OS=Oryza sativa... [more]
MPK5_ARATH2.633e-2483.61Mitogen-activated protein kinase 5 OS=Arabidopsis ... [more]
MPK6_ORYSJ3.439e-2481.97Mitogen-activated protein kinase 6 OS=Oryza sativa... [more]

Pages

back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw17 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117788 ID=EH117788|Name=EH117788|organism=Citrus sinensis|type=EST|length=211bp
GACGATGAGTCCTGAGTAACGAGAGATTGCTGGGCTTCAAATCCCGATGA
ATAACATTTGCTGAATGGATATACTTGAGTCCTCGAAGAAGTTGATACAA
GAAATACTGGCAGTGCTCCTCGGATAAACTTTGATTTGAGCGAATAATTT
GGTAAAGGTCAGTGTCCATGAGTTCCGCAGCAATATAGACATCAGTGAAT
TGGTACGCAGT
back to top