EH117786

Overview
NameEH117786
Unique NameEH117786
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length236
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6_DEBHA (40S ribosomal protein S6 OS=Debaryomyces hansenii GN=RPS6 PE=3 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.752e-29
Identity = 58/73 (79.45%), Postives = 67/73 (91.78%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVVVTQ 229
            +FKGY+FR++GGNDKQGFPMKQGV+ P RV+LL++KGHSCYRPRRTGERKRKSVRGCIV  DLAVL+L VV Q
Sbjct:   44 EFKGYIFRITGGNDKQGFPMKQGVMHPTRVKLLLAKGHSCYRPRRTGERKRKSVRGCIVAQDLAVLALSVVKQ 116          
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6_CANGA (40S ribosomal protein S6 OS=Candida glabrata GN=RPS6A PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.595e-29
Identity = 58/71 (81.69%), Postives = 67/71 (94.37%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 223
            +FKGY F+++GGNDKQGFPMKQGVLLP RV+LL++KGHSCYRPRR+GERKRKSVRG IVG DLAVLSLV+V
Sbjct:   44 EFKGYTFKITGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRSGERKRKSVRGAIVGPDLAVLSLVIV 114          
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6_KLULA (40S ribosomal protein S6 OS=Kluyveromyces lactis GN=RPS6 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.366e-28
Identity = 56/70 (80.00%), Postives = 66/70 (94.29%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVV 220
            +FKGYVF+++GGNDKQGFPMKQGVLLP RV+LL++KGHSCYRPRR GERKRKSVRG IVG DLAVL+L++
Sbjct:   44 EFKGYVFKIAGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRNGERKRKSVRGAIVGPDLAVLALII 113          
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6B_SCHPO (40S ribosomal protein S6-B OS=Schizosaccharomyces pombe GN=rps6b PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.366e-28
Identity = 57/73 (78.08%), Postives = 64/73 (87.67%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVVVTQ 229
            +F GYVF+++GGNDKQGFPM QGVLLPHRVRLL+  GH CYRPRR GERKRKSVRGCIVG DLAVL+L +V Q
Sbjct:   44 EFAGYVFKITGGNDKQGFPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVRGCIVGQDLAVLALAIVKQ 116          
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6A_SCHPO (40S ribosomal protein S6-A OS=Schizosaccharomyces pombe GN=rps6a PE=1 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 1.784e-28
Identity = 56/73 (76.71%), Postives = 64/73 (87.67%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVVVTQ 229
            +F GYVF+++GGNDKQGFPM QGVLLPHRVRLL+  GH CYRPRR GERKRKSVRGCIVG DLAVL+L ++ Q
Sbjct:   44 EFAGYVFKITGGNDKQGFPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVRGCIVGQDLAVLALAIIKQ 116          
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6_KLUMA (40S ribosomal protein S6 OS=Kluyveromyces marxianus GN=RPS6 PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.330e-28
Identity = 58/71 (81.69%), Postives = 66/71 (92.96%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 223
            +FKGYVF+++GGNDKQGFPMKQGVLLP RV+LLM+KG SCYRPRR GERKRKSVRG IVG DLAVL+LV+V
Sbjct:   44 EFKGYVFKIAGGNDKQGFPMKQGVLLPTRVKLLMAKGTSCYRPRRNGERKRKSVRGAIVGPDLAVLALVIV 114          
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6_ASHGO (40S ribosomal protein S6 OS=Ashbya gossypii GN=RPS6 PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 8.854e-28
Identity = 56/70 (80.00%), Postives = 65/70 (92.86%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVV 220
            +FKGYVF+++GGNDKQGFPMKQGVLLP RV+LLM+KG SCYRPRR GERKRKSVRG IVG DLAVL+L++
Sbjct:   44 EFKGYVFKIAGGNDKQGFPMKQGVLLPTRVKLLMAKGTSCYRPRRNGERKRKSVRGAIVGPDLAVLALII 113          
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6_XENLA (40S ribosomal protein S6 OS=Xenopus laevis GN=rps6 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.156e-27
Identity = 57/71 (80.28%), Postives = 66/71 (92.96%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 223
            ++KGYV R+SGGNDKQGFPMKQGVL   RVRLL+SKGHSCYRPRRTGERKRKSVRGCIV ++L+VL+LV+V
Sbjct:   44 EWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIV 114          
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6_RAT (40S ribosomal protein S6 OS=Rattus norvegicus GN=Rps6 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.156e-27
Identity = 57/71 (80.28%), Postives = 66/71 (92.96%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 223
            ++KGYV R+SGGNDKQGFPMKQGVL   RVRLL+SKGHSCYRPRRTGERKRKSVRGCIV ++L+VL+LV+V
Sbjct:   44 EWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIV 114          
BLAST of EH117786 vs. ExPASy Swiss-Prot
Match: RS6_MOUSE (40S ribosomal protein S6 OS=Mus musculus GN=Rps6 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.156e-27
Identity = 57/71 (80.28%), Postives = 66/71 (92.96%), Query Frame = 2
Query:   11 QFKGYVFRVSGGNDKQGFPMKQGVLLPHRVRLLMSKGHSCYRPRRTGERKRKSVRGCIVGSDLAVLSLVVV 223
            ++KGYV R+SGGNDKQGFPMKQGVL   RVRLL+SKGHSCYRPRRTGERKRKSVRGCIV ++L+VL+LV+V
Sbjct:   44 EWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIV 114          
The following BLAST results are available for this feature:
BLAST of EH117786 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
RS6_DEBHA2.752e-2979.4540S ribosomal protein S6 OS=Debaryomyces hansenii ... [more]
RS6_CANGA3.595e-2981.6940S ribosomal protein S6 OS=Candida glabrata GN=RP... [more]
RS6_KLULA1.366e-2880.0040S ribosomal protein S6 OS=Kluyveromyces lactis G... [more]
RS6B_SCHPO1.366e-2878.0840S ribosomal protein S6-B OS=Schizosaccharomyces ... [more]
RS6A_SCHPO1.784e-2876.7140S ribosomal protein S6-A OS=Schizosaccharomyces ... [more]
RS6_KLUMA2.330e-2881.6940S ribosomal protein S6 OS=Kluyveromyces marxianu... [more]
RS6_ASHGO8.854e-2880.0040S ribosomal protein S6 OS=Ashbya gossypii GN=RPS... [more]
RS6_XENLA1.156e-2780.2840S ribosomal protein S6 OS=Xenopus laevis GN=rps6... [more]
RS6_RAT1.156e-2780.2840S ribosomal protein S6 OS=Rattus norvegicus GN=R... [more]
RS6_MOUSE1.156e-2780.2840S ribosomal protein S6 OS=Mus musculus GN=Rps6 P... [more]

Pages

back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw16 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117786 ID=EH117786|Name=EH117786|organism=Citrus sinensis|type=EST|length=236bp
GACTGCGTACCAATTCAAGGGTTACGTTTTCCGTGTCTCTGGTGGTAACG
ATAAGCAAGGTTTCCCCATGAAGCAAGGTGTTCTCTTACCTCACCGTGTT
CGTCTCTTGATGTCCAAGGGTCACTCTTGTTATCGTCCTCGCCGTACTGG
TGAACGTAAGAGAAAGTCCGTTCGTGGTTGTATCGTTGGTTCTGACCTCG
CTGTCTTGTCTCTCGTTGTTGTTACTCAGGACTCAT
back to top