EH117783

Overview
NameEH117783
Unique NameEH117783
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length230
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1602 contig Csv1_Contig1602:84..313. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EH117783 vs. ExPASy Swiss-Prot
Match: U326_ARATH (UPF0326 protein At4g17486 OS=Arabidopsis thaliana GN=At4g17486 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.927e-14
Identity = 33/68 (48.53%), Postives = 48/68 (70.59%), Query Frame = -1
Query:   15 FRTFIECSAAEYHGDTYNLISKNCNHFTDDIAWRLTGKHVPGWVNXXXXXXXXXXXXLPESLQATTVT 218
            FR+++E  + +YHGDTY+LI+KNCNHFT+++  +LTGK +PGW+N            LPES+Q T V+
Sbjct:  102 FRSYMEKLSRKYHGDTYHLIAKNCNHFTEEVCLQLTGKPIPGWINRLARVGSFCNCLLPESIQLTAVS 169          
The following BLAST results are available for this feature:
BLAST of EH117783 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
U326_ARATH1.927e-1448.53UPF0326 protein At4g17486 OS=Arabidopsis thaliana ... [more]
back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw14 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117783 ID=EH117783|Name=EH117783|organism=Citrus sinensis|type=EST|length=230bp
GACGATGAGTCCTGAGTAACAGTAGTTGCTTGAAGGCTTTCAGGAAGTAG
ACAACCGCATAAAGCACCTAGCCGGGCCAGCCGATTCACCCACCCAGGGA
CGTGTTTGCCAGTCAATCTCCATGCAATATCATCTGTAAAATGGTTGCAA
TTCTTTGAGATGAGGTTATAAGTGTCTCCATGATACTCAGCTGCTGAACA
CTCAATAAATGTCCTGAATTGGTACGCAGT
back to top