EH117780

Overview
NameEH117780
Unique NameEH117780
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length291
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EH117780 vs. ExPASy Swiss-Prot
Match: GGH_ARATH (Gamma-glutamyl hydrolase OS=Arabidopsis thaliana GN=GGH PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 6.433e-23
Identity = 31/45 (68.89%), Postives = 38/45 (84.44%), Query Frame = 3
Query:  138 SEARWSVNRPPAQKVLDNLIYNYRPTFCGKAGKGFDEVYILTQHQ 272
            SEAR S+NRP ++KVL NLIYNY+PT+CG AG G+DEVYI TQ +
Sbjct:  300 SEARKSLNRPESKKVLSNLIYNYKPTYCGYAGIGYDEVYIFTQQR 344          

HSP 2 Score: 56.9954 bits (136), Expect = 6.433e-23
Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = 1
Query:   43 KKNAFEWGSSAIPHSEDAIEVTQHVANYFIS 135
            +KNAFEWGSS IPHSEDAI+VTQH AN+ +S
Sbjct:  270 EKNAFEWGSSKIPHSEDAIQVTQHAANHLVS 300          
BLAST of EH117780 vs. ExPASy Swiss-Prot
Match: GGH_SOYBN (Gamma-glutamyl hydrolase OS=Glycine max PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 7.216e-17
Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = 3
Query:  138 SEARWSVNRPPAQKVLDNLIYNYRPTFCGKAGKGFDEVYI 257
            SEAR S N P AQKV D+LIYNY+PTF G AGKG+D+VY+
Sbjct:  301 SEARKSTNTPDAQKVRDSLIYNYKPTFGGTAGKGYDQVYL 340          

HSP 2 Score: 44.669 bits (104), Expect = 7.216e-17
Identity = 21/32 (65.62%), Postives = 25/32 (78.12%), Query Frame = 1
Query:   43 KKNAFEWGSSA-IPHSEDAIEVTQHVANYFIS 135
            +KNAFEW +S   PH+EDAI VTQ  AN+FIS
Sbjct:  270 EKNAFEWATSLKAPHTEDAIRVTQSTANFFIS 301          
The following BLAST results are available for this feature:
BLAST of EH117780 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
GGH_ARATH6.433e-2368.89Gamma-glutamyl hydrolase OS=Arabidopsis thaliana G... [more]
GGH_SOYBN7.216e-1770.00Gamma-glutamyl hydrolase OS=Glycine max PE=2 SV=1[more]
back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw2 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117780 ID=EH117780|Name=EH117780|organism=Citrus sinensis|type=EST|length=291bp
GACGATGAGTCCTGAGTAACAGCAAGTGCAGATGAGGATAATAAGAAAAA
TGCTTTTGAATGGGGATCATCAGCAATTCCACACTCAGAGGATGCCATTG
AGGTGACTCAACATGTCGCAAACTATTTTATCAGTGCAGTGAGGCTCGGT
GGTCGGTAAACAGGCCTCCTGCTCAGAAAGTGCTTGACAATCTCATTTAC
AATTACAGGCCCACATTTTGTGGGAAGGCTGGGAAGGGGTTTGATGAGGT
TTACATCCTTACCCAACATCAACCCTGAATTGGTACGCAGT
back to top