EH117779

Overview
NameEH117779
Unique NameEH117779
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length275
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4023 contig Csv1_Contig4023:297..571. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL131_ARATH (60S ribosomal protein L13-1 OS=Arabidopsis thaliana GN=RPL13B PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.507e-32
Identity = 67/82 (81.71%), Postives = 73/82 (89.02%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELV 258
            I KKLAPTIG++VDHRRKNRSLEGLQ+NVQR KTYK KLV+FPRRARK KAGDS PEELA ATQVQG Y+PI  EKPT+ELV
Sbjct:   84 IPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKTKLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTMELV 165          
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL133_ARATH (60S ribosomal protein L13-3 OS=Arabidopsis thaliana GN=RPL13D PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 3.815e-31
Identity = 68/82 (82.93%), Postives = 72/82 (87.80%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELV 258
            I KKLAPTIG+SVDHRRKNRSLEGLQSNVQR KTYKAKLVVFPRR+R+ KAGDS PEELA ATQVQG YMPIA  K  +ELV
Sbjct:   84 IPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIASVKAAMELV 165          
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL132_BRANA (60S ribosomal protein L13-2 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 8.500e-31
Identity = 67/82 (81.71%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELV 258
            I KKLAPTIG+S+DHRRKNRSLEGLQSNVQR KTYKAKLV+FPRRARK KAGDS  EELA ATQVQG YMPI  EK  +ELV
Sbjct:   84 IPKKLAPTIGISLDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQAMELV 165          
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL131_BRANA (60S ribosomal protein L13-1 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 1.450e-30
Identity = 67/82 (81.71%), Postives = 70/82 (85.37%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELV 258
            I KKLAPTIG++VDHRRKNRSLEGLQSNVQR KTYKAKLV+FPRRARK KAGDS  EELA ATQVQG YMPI  EK   ELV
Sbjct:   84 IPKKLAPTIGIAVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKHATELV 165          
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL132_ARATH (Putative 60S ribosomal protein L13-2 OS=Arabidopsis thaliana GN=RPL13C PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 5.701e-27
Identity = 61/82 (74.39%), Postives = 67/82 (81.71%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELV 258
            I KKLAPTIG+SVDH RKNRSLEG Q+NVQR KTYKAKLV+FPR AR  K GDSA +ELA ATQVQ  +MPI  E PT+ELV
Sbjct:   84 IPKKLAPTIGISVDHHRKNRSLEGFQTNVQRLKTYKAKLVIFPRCARTVKVGDSAQQELANATQVQVDHMPIVREMPTMELV 165          
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL13_DANRE (60S ribosomal protein L13 OS=Danio rerio GN=rpl13 PE=2 SV=3)

HSP 1 Score: 93.9745 bits (232), Expect = 2.565e-19
Identity = 46/72 (63.89%), Postives = 56/72 (77.78%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPI 228
            I+KK+A TIG+SVD RR+NRS E LQ+NVQR K Y+ KL++FPR+A K K GDS  EEL  ATQ+ GP MPI
Sbjct:   86 INKKVARTIGISVDSRRRNRSTESLQANVQRLKEYRTKLIIFPRKAAKPKKGDSTEEELKMATQLTGPVMPI 157          
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL13_CHLSW (60S ribosomal protein L13 OS=Chlamydomonas sp. (strain W80) GN=RPL13 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.715e-19
Identity = 44/82 (53.66%), Postives = 61/82 (74.39%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELV 258
            I  K APT+G++VDHRRKNRSLE LQ+NVQR KTY+A LV+FPR  +K KA +++  + + A+Q +G  +P+   KP +ELV
Sbjct:   85 IPAKFAPTVGIAVDHRRKNRSLETLQANVQRLKTYRASLVIFPRNMKKPKAFEASAADCSAASQAKGELLPLKGTKPALELV 166          
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL13_TOBAC (60S ribosomal protein L13 OS=Nicotiana tabacum GN=RPL13 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 9.748e-19
Identity = 47/76 (61.84%), Postives = 56/76 (73.68%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEK 240
            I KKLAPTIG++VDHRR+NRSLEGLQ+NVQR +  + +LVVFPRRA + +     P    TATQV G YMPI  EK
Sbjct:   80 IPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLEDLQGQLVVFPRRASRSRLVILPPRNCLTATQVHGAYMPIEREK 155          
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL13_RAT (60S ribosomal protein L13 OS=Rattus norvegicus GN=Rpl13 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.663e-18
Identity = 44/72 (61.11%), Postives = 56/72 (77.78%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPI 228
            IHKK+A TIG+SVD RR+N+S E LQ+NVQR K Y++KL++FPR+    K GDS+ EEL  ATQ+ GP MPI
Sbjct:   86 IHKKMARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPI 157          
BLAST of EH117779 vs. ExPASy Swiss-Prot
Match: RL13_MOUSE (60S ribosomal protein L13 OS=Mus musculus GN=Rpl13 PE=2 SV=3)

HSP 1 Score: 90.8929 bits (224), Expect = 2.172e-18
Identity = 44/72 (61.11%), Postives = 56/72 (77.78%), Query Frame = 1
Query:   13 IHKKLAPTIGVSVDHRRKNRSLEGLQSNVQRPKTYKAKLVVFPRRARKFKAGDSAPEELATATQVQGPYMPI 228
            IHKK+A TIG+SVD RR+N+S E LQ+NVQR K Y++KL++FPR+    K GDS+ EEL  ATQ+ GP MPI
Sbjct:   86 IHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPI 157          
The following BLAST results are available for this feature:
BLAST of EH117779 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
RL131_ARATH4.507e-3281.7160S ribosomal protein L13-1 OS=Arabidopsis thalian... [more]
RL133_ARATH3.815e-3182.9360S ribosomal protein L13-3 OS=Arabidopsis thalian... [more]
RL132_BRANA8.500e-3181.7160S ribosomal protein L13-2 OS=Brassica napus PE=2... [more]
RL131_BRANA1.450e-3081.7160S ribosomal protein L13-1 OS=Brassica napus PE=2... [more]
RL132_ARATH5.701e-2774.39Putative 60S ribosomal protein L13-2 OS=Arabidopsi... [more]
RL13_DANRE2.565e-1963.8960S ribosomal protein L13 OS=Danio rerio GN=rpl13 ... [more]
RL13_CHLSW5.715e-1953.6660S ribosomal protein L13 OS=Chlamydomonas sp. (st... [more]
RL13_TOBAC9.748e-1961.8460S ribosomal protein L13 OS=Nicotiana tabacum GN=... [more]
RL13_RAT1.663e-1861.1160S ribosomal protein L13 OS=Rattus norvegicus GN=... [more]
RL13_MOUSE2.172e-1861.1160S ribosomal protein L13 OS=Mus musculus GN=Rpl13... [more]

Pages

back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw5 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117779 ID=EH117779|Name=EH117779|organism=Citrus sinensis|type=EST|length=275bp
GACTGCGTACCAATTCACAAGAAACTGGCTCCGACAATTGGTGTTTCAGT
CGATCATCGACGCAAGAACCGTTCTCTTGAGGGTCTTCAATCTAATGTTC
AGAGGCCCAAGACTTACAAGGCTAAGTTGGTTGTTTTCCCAAGACGTGCT
CGCAAGTTCAAGGCTGGTGATTCTGCCCCTGAGGAATTGGCAACAGCAAC
TCAAGTACAAGGACCTTACATGCCCATTGCTCCTGAGAAGCCTACTGTCG
AGCTGGTTACTCAGGGACTCATCGT
back to top