EH117775

Overview
NameEH117775
Unique NameEH117775
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length207
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9664 contig Csv1_Contig9664:865..1071. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CATB_PIG (Cathepsin B OS=Sus scrofa GN=CTSB PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.409e-17
Identity = 37/58 (63.79%), Postives = 49/58 (84.48%), Query Frame = -2
Query:   18 QHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 191
            +H+  S+Y I+ + ++IMAEIYKNGPVE +FTVY DF  YKSGVY+H+TGD+MGGHA+
Sbjct:  223 KHFGCSSYSISRNEKEIMAEIYKNGPVEGAFTVYSDFLQYKSGVYQHVTGDLMGGHAI 280          
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CATB_MACFA (Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 6.991e-17
Identity = 35/58 (60.34%), Postives = 49/58 (84.48%), Query Frame = -2
Query:   18 QHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 191
            +HY  ++Y +++  +DIMAEIYKNGPVE +F+VY DF  YKSGVY+H+TG++MGGHA+
Sbjct:  223 KHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAI 280          
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CATB_HUMAN (Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3)

HSP 1 Score: 85.8853 bits (211), Expect = 6.991e-17
Identity = 35/58 (60.34%), Postives = 49/58 (84.48%), Query Frame = -2
Query:   18 QHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 191
            +HY  ++Y +++  +DIMAEIYKNGPVE +F+VY DF  YKSGVY+H+TG++MGGHA+
Sbjct:  223 KHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAI 280          
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CATB_PONAB (Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.130e-17
Identity = 35/58 (60.34%), Postives = 48/58 (82.76%), Query Frame = -2
Query:   18 QHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 191
            +HY  ++Y +++   DIMAEIYKNGPVE +F+VY DF  YKSGVY+H+TG++MGGHA+
Sbjct:  223 KHYGYNSYSVSNSERDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAI 280          
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CATB_RAT (Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 2.034e-16
Identity = 36/58 (62.07%), Postives = 46/58 (79.31%), Query Frame = -2
Query:   18 QHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 191
            +HY  ++Y ++   ++IMAEIYKNGPVE +FTV+ DF  YKSGVYKH  GDVMGGHA+
Sbjct:  223 KHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAI 280          
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CATB_BOVIN (Cathepsin B OS=Bos taurus GN=CTSB PE=1 SV=5)

HSP 1 Score: 82.4185 bits (202), Expect = 7.729e-16
Identity = 33/58 (56.90%), Postives = 49/58 (84.48%), Query Frame = -2
Query:   18 QHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 191
            +H+  S+Y + ++ ++IMAEIYKNGPVE +F+VY DF  YKSGVY+H++G++MGGHA+
Sbjct:  223 KHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAI 280          
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CATB_MOUSE (Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 1.318e-15
Identity = 34/58 (58.62%), Postives = 47/58 (81.03%), Query Frame = -2
Query:   18 QHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 191
            +H+  ++Y +++  ++IMAEIYKNGPVE +FTV+ DF  YKSGVYKH  GD+MGGHA+
Sbjct:  223 KHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAI 280          
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CYSP_SCHMA (Cathepsin B-like cysteine proteinase OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.722e-15
Identity = 35/61 (57.38%), Postives = 45/61 (73.77%), Query Frame = -2
Query:   18 TNSQHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 200
            T  +H   S+Y + +D + I  EI K GPVE SFTVYEDF +YKSG+YKHITG+ +GGHA+
Sbjct:  229 TQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEASFTVYEDFLNYKSGIYKHITGEALGGHAI 289          
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CATB_CHICK (Cathepsin B OS=Gallus gallus GN=CTSB PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.722e-15
Identity = 34/58 (58.62%), Postives = 47/58 (81.03%), Query Frame = -2
Query:   18 QHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 191
            +HY I++Y +    ++IMAEIYKNGPVE +F VYEDF  YKSGVY+H++G+ +GGHA+
Sbjct:  224 KHYGITSYGVPRSEKEIMAEIYKNGPVEGAFIVYEDFLMYKSGVYQHVSGEQVGGHAI 281          
BLAST of EH117775 vs. ExPASy Swiss-Prot
Match: CPR1_CAEEL (Gut-specific cysteine proteinase OS=Caenorhabditis elegans GN=cpr-1 PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 1.458e-14
Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = -2
Query:   18 QHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAV 191
            +H+ +SAY +  +   I AEIY NGPVE +F+VYEDF  YKSGVYKH  G  +GGHA+
Sbjct:  220 KHFGVSAYAVPKNAASIQAEIYANGPVEAAFSVYEDFYKYKSGVYKHTAGKYLGGHAI 277          
The following BLAST results are available for this feature:
BLAST of EH117775 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
CATB_PIG1.409e-1763.79Cathepsin B OS=Sus scrofa GN=CTSB PE=1 SV=1[more]
CATB_MACFA6.991e-1760.34Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV... [more]
CATB_HUMAN6.991e-1760.34Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3[more]
CATB_PONAB9.130e-1760.34Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1[more]
CATB_RAT2.034e-1662.07Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2[more]
CATB_BOVIN7.729e-1656.90Cathepsin B OS=Bos taurus GN=CTSB PE=1 SV=5[more]
CATB_MOUSE1.318e-1558.62Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2[more]
CYSP_SCHMA1.722e-1557.38Cathepsin B-like cysteine proteinase OS=Schistosom... [more]
CATB_CHICK1.722e-1558.62Cathepsin B OS=Gallus gallus GN=CTSB PE=2 SV=1[more]
CPR1_CAEEL1.458e-1456.90Gut-specific cysteine proteinase OS=Caenorhabditis... [more]

Pages

back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw7 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117775 ID=EH117775|Name=EH117775|organism=Citrus sinensis|type=EST|length=207bp
GACGATGAGTCCTGAGTAACAGCATGACCCCCCATTACATCGCCTGTGAT
GTGTTTGTAGACCCCAGATTTGTAGTGAGCAAAATCCTCATAAACTGTGA
AGGAAACTTCAACTGGTCCATTCTTGTAAATTTCTGCCATTATGTCCTCT
GGATCAGAATTGATTCTATATGCACTAATACTGTAGTGCTGTGAATTGGT
ACGCAGT
back to top