EH117772

Overview
NameEH117772
Unique NameEH117772
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length390
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5631 contig Csv1_Contig5631:603..992. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EH117772 vs. ExPASy Swiss-Prot
Match: Y4372_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g37250 OS=Arabidopsis thaliana GN=At4g37250 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 2.743e-21
Identity = 56/118 (47.46%), Postives = 74/118 (62.71%), Query Frame = 3
Query:   12 KKYVHGDLKPSNILLGHNMEPHISDFGLARLAN------IAGGSPTLQSNRMPAEKPQERQQKSVSLEVTTTNSSSNLESYYQAPESLKVVKPSQKWDIYSYGVILLEMITGRTAVVQ 347
            KK+VHG+LKPSNILLGH+MEP I DFGL RL         AGGS  + S++        R+  S+    + + SS    S Y APES + +KPS KWD+Y +GVILLE++TG+   V+
Sbjct:  571 KKHVHGNLKPSNILLGHDMEPKIGDFGLERLLTGETSYIRAGGSSRIFSSK--RYTTSSREFSSIGPTPSPSPSSVGAMSPYCAPESFRSLKPSPKWDVYGFGVILLELLTGKIVSVE 686          
BLAST of EH117772 vs. ExPASy Swiss-Prot
Match: RPKL_ARATH (Receptor protein kinase-like protein At4g34220 OS=Arabidopsis thaliana GN=At4g34220 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.845e-12
Identity = 43/107 (40.19%), Postives = 59/107 (55.14%), Query Frame = 3
Query:   12 KKYVHGDLKPSNILLGHNMEPHISDFGLARLANIAGGSPTLQSNRMPAEKPQERQQKSVSLEVTTTNSSSNLESYYQAPESLKVVKPSQKWDIYSYGVILLEMITGR 332
            KK VHG++KP+NILL    EP I+D GL RL      +P  +S+                    TT  +S+  S YQ PE    +KP+ KWD+YS+GVILLE++T +
Sbjct:  599 KKQVHGNIKPNNILLNAENEPIITDLGLDRLM-----TPARESH--------------------TTGPTSS--SPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSK 678          
BLAST of EH117772 vs. ExPASy Swiss-Prot
Match: RPK1_IPONI (Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 8.845e-12
Identity = 42/118 (35.59%), Postives = 61/118 (51.69%), Query Frame = 3
Query:   21 VHGDLKPSNILLGHNMEPHISDFGLARLANIAGGSPTLQSNRMPAEKPQERQQKSVSLEVTTTNSSSNLESYYQAPESLKVVKPSQKWDIYSYGVILLEMITGRTAVVQVGSSEMDLV 374
            VH D+KP NILL  ++EPHISDFG+A+L +                      Q + S+   T   +      Y APE+      S++ D+YSYGV+LLE+IT + A+    + E D+V
Sbjct:  939 VHRDIKPMNILLDSDLEPHISDFGIAKLLD----------------------QSATSIPSNTVQGTIG----YMAPENAFTTVKSRESDVYSYGVVLLELITRKKALDPSFNGETDIV 1030          
BLAST of EH117772 vs. ExPASy Swiss-Prot
Match: GSO1_ARATH (LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.733e-11
Identity = 44/122 (36.07%), Postives = 61/122 (50.00%), Query Frame = 3
Query:   21 VHGDLKPSNILLGHNMEPHISDFGLARLANIAGGSPTLQSNRMPAEKPQERQQKSVSLEVTTTNSSSNLE---SY-YQAPESLKVVKPSQKWDIYSYGVILLEMITGRTAVVQVGSSEMDLV 374
            VH D+K SN+LL  NME H+ DFGLA+                            V  E   TN+ SN     SY Y APE    +K ++K D+YS G++L+E++TG+     V  +EMD+V
Sbjct: 1081 VHRDIKSSNVLLDSNMEAHLGDFGLAK----------------------------VLTENCDTNTDSNTWFACSYGYIAPEYAYSLKATEKSDVYSMGIVLMEIVTGKMPTDSVFGAEMDMV 1174          
BLAST of EH117772 vs. ExPASy Swiss-Prot
Match: Y4265_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.779e-11
Identity = 40/105 (38.10%), Postives = 59/105 (56.19%), Query Frame = 3
Query:   21 VHGDLKPSNILLGHNMEPHISDFGLARLANIAGGSPTLQSNRMPAEKPQERQQKSVSLEVTTTNSSSNLESY-YQAPESLKVVKPSQKWDIYSYGVILLEMITGR 332
            +HGD+K  N+LLG + EP+++DFGLAR  +   G P   +  +   KP              TN      SY Y APE   + + ++K D+YSYGV+LLE++TG+
Sbjct:  880 IHGDVKAMNVLLGPHFEPYLADFGLARTIS---GYP---NTGIDLAKP--------------TNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGK 964          
The following BLAST results are available for this feature:
BLAST of EH117772 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
Y4372_ARATH2.743e-2147.46Probable LRR receptor-like serine/threonine-protei... [more]
RPKL_ARATH8.845e-1240.19Receptor protein kinase-like protein At4g34220 OS=... [more]
RPK1_IPONI8.845e-1235.59Receptor-like protein kinase OS=Ipomoea nil GN=INR... [more]
GSO1_ARATH5.733e-1136.07LRR receptor-like serine/threonine-protein kinase ... [more]
Y4265_ARATH9.779e-1138.10Probable LRR receptor-like serine/threonine-protei... [more]
back to top
Libraries
Library NameType
Different expression profile of FJWC and FJ72-1cdna_library
Properties
Property NameValue
Genbank descriptionfjfw6 Different expression profile of FJWC and FJ72-1 Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EH117772 ID=EH117772|Name=EH117772|organism=Citrus sinensis|type=EST|length=390bp
AATTCATCCCCAAAAAGTATGTCCATGGAGATCTGAAACCTAGCAATATT
CTGCTTGGACATAATATGGAACCACACATATCTGATTTTGGACTTGCACG
CCTTGCTAATATTGCTGGAGGGTCTCCAACACTGCAATCTAATAGAATGC
CGGCAGAGAAGCCTCAAGAAAGACAACAGAAGAGTGTGTCCTTGGAGGTT
ACTACAACCAACTCTTCAAGTAACTTGGAATCTTATTATCAGGCCCCCGA
ATCACTAAAGGTGGTGAAACCATCACAGAAATGGGATATTTACTCGTACG
GAGTGATTTTGCTTGAAATGATCACTGGAAGAACAGCAGTTGTTCAGGTG
GGATCCTCAGAAATGGATCTTGTTACTCAGGACTCATCAA
back to top