EY664696

Overview
NameEY664696
Unique NameEY664696
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length695
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8095 contig Csv1_Contig8095:160..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY664696 vs. ExPASy Swiss-Prot
Match: PSAN_ARATH (Photosystem I reaction center subunit N, chloroplastic OS=Arabidopsis thaliana GN=PSAN PE=1 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 1.267e-51
Identity = 109/170 (64.12%), Postives = 125/170 (73.53%), Query Frame = 3
Query:   48 NSSVLACNYAISGSAGSSELNAKIVSVSTPAVHGHK----MPVIRAQQVDVSKESRGTDGRRXXXXXXXXXXXXXXXXXXXXXXXGVIDEYLERSKANKELNDQKRLATSGANFARAYTVQFGTCKFPENFTGCQDLAKQKKVPFISDDLELECKGKDKYKCGSNVFWKW 545
            NSSVL C+YAI+GS GS ELN K+  V++    G K    MPVI+AQ+V V  +  G++GRR                       GVIDEYLERSK NKELND+KRLATSGANFARA+TVQFG+CKFPENFTGCQDLAKQKKVPFIS+D+ LEC+GKDKYKCGSNVFWKW
Sbjct:    5 NSSVLTCSYAIAGS-GSVELNQKVGLVNSSVGFGQKKQMIMPVIKAQRV-VGDDVDGSNGRRSAMVFLAATLFSTAAVSASANA-GVIDEYLERSKTNKELNDKKRLATSGANFARAFTVQFGSCKFPENFTGCQDLAKQKKVPFISEDIALECEGKDKYKCGSNVFWKW 171          
BLAST of EY664696 vs. ExPASy Swiss-Prot
Match: PSAN_MAIZE (Photosystem I reaction center subunit N, chloroplastic (Fragment) OS=Zea mays GN=PSAN PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 6.520e-40
Identity = 72/84 (85.71%), Postives = 82/84 (97.62%), Query Frame = 3
Query:  294 VIDEYLERSKANKELNDQKRLATSGANFARAYTVQFGTCKFPENFTGCQDLAKQKKVPFISDDLELECKGKDKYKCGSNVFWKW 545
            + DEYLE+SKANKELND+KRLATSGANFARAYTV+FG+C+FP NFTGCQDLAKQKKVPFISDDLE+EC+GK+K+KCGSNVFWKW
Sbjct:   29 IFDEYLEKSKANKELNDKKRLATSGANFARAYTVEFGSCQFPYNFTGCQDLAKQKKVPFISDDLEIECEGKEKFKCGSNVFWKW 112          
BLAST of EY664696 vs. ExPASy Swiss-Prot
Match: PSAN_HORVU (Photosystem I reaction center subunit N, chloroplastic OS=Hordeum vulgare GN=PSAN PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.478e-39
Identity = 72/84 (85.71%), Postives = 80/84 (95.24%), Query Frame = 3
Query:  294 VIDEYLERSKANKELNDQKRLATSGANFARAYTVQFGTCKFPENFTGCQDLAKQKKVPFISDDLELECKGKDKYKCGSNVFWKW 545
            V DEYLE+SK NKELND+KR ATSGANFARAYTVQFG+CKFP NFTGCQDLAKQKKVPFI+DDLE+EC+GK+K+KCGSNVFWKW
Sbjct:   62 VFDEYLEKSKLNKELNDKKRAATSGANFARAYTVQFGSCKFPYNFTGCQDLAKQKKVPFITDDLEIECEGKEKFKCGSNVFWKW 145          
BLAST of EY664696 vs. ExPASy Swiss-Prot
Match: PSAN_VOLCA (Photosystem I reaction center subunit N, chloroplastic OS=Volvox carteri GN=PSAN PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.510e-20
Identity = 46/79 (58.23%), Postives = 62/79 (78.48%), Query Frame = 3
Query:  291 GVIDEYLERSKANKELNDQKRLATSGANFARAYTVQFGTCKFPENFTGCQDLAKQKKVPFISDDLELECKGKDKYKCGS 527
            GV+++ L +S ANK LN++KRLATS AN AR+ TV  GTC+FPENF GC++LA  K V +I++DL++EC+GKD   CGS
Sbjct:   54 GVVEDLLAKSAANKALNNKKRLATSYANLARSRTVYDGTCQFPENFFGCEELAFNKGVKYIAEDLKIECEGKDAKSCGS 132          
The following BLAST results are available for this feature:
BLAST of EY664696 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
PSAN_ARATH1.267e-5164.12Photosystem I reaction center subunit N, chloropla... [more]
PSAN_MAIZE6.520e-4085.71Photosystem I reaction center subunit N, chloropla... [more]
PSAN_HORVU2.478e-3985.71Photosystem I reaction center subunit N, chloropla... [more]
PSAN_VOLCA1.510e-2058.23Photosystem I reaction center subunit N, chloropla... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-069-D06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY664696 ID=EY664696; Name=EY664696; organism=Citrus sinensis; type=EST; length=695bp
AAAACAAAAAAAAAATTTGCGCTGCAGCAGGAGCGATGGCAGCCATGAAC
TCTAGTGTACTCGCATGCAACTATGCCATTTCAGGCAGTGCTGGATCATC
TGAGCTCAATGCAAAGATTGTTTCGGTTTCAACCCCGGCTGTGCATGGCC
ACAAAATGCCTGTGATCAGAGCTCAACAAGTTGATGTTTCAAAAGAATCA
AGAGGAACTGATGGAAGGAGAGCTGCCATGGCTCTTCTAGCAGTTACCCT
TTTCACCACAGCTACTGCTGCTGCTTCTTCTGCTAATGCTGGGGTCATCG
ATGAATACCTTGAGAGAAGCAAAGCCAACAAGGAATTGAATGACCAGAAG
AGATTGGCAACAAGTGGTGCAAACTTTGCCAGAGCATACACTGTTCAATT
TGGCACATGCAAGTTCCCTGAGAACTTCACAGGCTGCCAAGATCTTGCCA
AGCAAAAGAAAGTGCCATTCATCTCGGATGATTTGGAATTGGAGTGCAAA
GGGAAAGATAAATACAAGTGTGGTTCCAATGTTTTCTGGAAATGGTGAAG
TGGGACAACTGATCTCTTTAAACATTTTATTTTACCCTCCCATGTATCTA
AGTTTCCATTGAAGAAGCTTTACTTGTGCTTATTTGTGTGTTATATTTTT
CTGCTCAGTATCTTTTTATATCCTAAAAAAAAAAAAAAAAAAAAG
back to top