EY664694

Overview
NameEY664694
Unique NameEY664694
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 9.654e-93
Identity = 149/228 (65.35%), Postives = 189/228 (82.89%), Query Frame = 3
Query:   12 DKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAMISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTTLYGSRTVFFLTPDNTLRPLAIELTRPPMDDKPLWRKVYTPGSWNSTKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSP 695
            DKF W RDEEFAR+TLAG+NP +I+L+ E+PLKS LDP +YGP   ES IT D++E+++  +++VEEAI QK+LFMLD+HDLFLPYV K+R L+HTT+YGSRT+FFLT D TLR LAIELTRP    +P WR+V+TP S ++TK+WLWR+AKAHV AHD+G+H+L++HWLR+HC VEPYIIA NRQLS MHPIY+LLHPH RYT+ +NA+    LISA G+I  +FSP
Sbjct:  434 DKFAWLRDEEFARETLAGINPYAIELVREFPLKSKLDPAVYGPA--ESAITADLLEEQMRRVMTVEEAISQKRLFMLDFHDLFLPYVHKIRSLKHTTMYGSRTIFFLTDDGTLRLLAIELTRPASPSQPQWRQVFTP-STDTTKSWLWRMAKAHVRAHDAGHHELITHWLRTHCAVEPYIIAANRQLSEMHPIYQLLHPHFRYTMRINALARSRLISAAGIIELSFSP 658          

HSP 2 Score: 38.891 bits (89), Expect = 9.654e-93
Identity = 22/49 (44.90%), Postives = 27/49 (55.10%), Query Frame = 2
Query:  698 RYCMEMRSGIYDKQWRFDEQALPKTL-*EGNGRWKPNARHA-KANIDDY 838
            +Y ME+ S  YDK WRFD +ALP  L   G     P A H  +  I+DY
Sbjct:  660 KYSMELSSVAYDKLWRFDMEALPADLVRRGMAEEDPTAEHGLRLAIEDY 708          
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2)

HSP 1 Score: 319.701 bits (818), Expect = 4.759e-92
Identity = 148/228 (64.91%), Postives = 187/228 (82.02%), Query Frame = 3
Query:   12 DKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAMISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTTLYGSRTVFFLTPDNTLRPLAIELTRPPMDDKPLWRKVYTPGSWNSTKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSP 695
            DKF W RDEEFAR+TLAG+NP +I+L+ E+PLKS LDP +YGP   ES IT D++E+++  +++VEEAI QK+LFMLD+HDLFLPYV K+R L+HTT+YGSRTVFFLT D TL+ LAIELTRP    +P WR+V+TP S ++T +WLWR+AKAHV AHD+G+H+L++HWLR+HC VEPYIIA NRQLS MHPIY+LL PH RYT+ +NA     LISAGG+I  +FSP
Sbjct:  417 DKFAWLRDEEFARETLAGINPYAIELVREFPLKSKLDPAVYGPA--ESAITADLLEEQMRRVMTVEEAISQKRLFMLDFHDLFLPYVHKIRSLDHTTMYGSRTVFFLTDDGTLQLLAIELTRPASPSQPQWRQVFTP-STDATMSWLWRMAKAHVRAHDAGHHELITHWLRTHCAVEPYIIAANRQLSEMHPIYQLLRPHFRYTMRINARARSALISAGGIIERSFSP 641          

HSP 2 Score: 40.4318 bits (93), Expect = 4.759e-92
Identity = 23/49 (46.94%), Postives = 27/49 (55.10%), Query Frame = 2
Query:  698 RYCMEMRSGIYDKQWRFDEQALPKTL-*EGNGRWKPNARHA-KANIDDY 838
            +Y ME+ S  YDK WRFD +ALP  L   G     P A H  K  I+DY
Sbjct:  643 KYSMELSSVAYDKLWRFDTEALPADLVRRGMAEEDPTAEHGLKLAIEDY 691          
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOX22_HORVU (Lipoxygenase 2.2, chloroplastic OS=Hordeum vulgare GN=LOX2.2 PE=1 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 6.792e-91
Identity = 153/233 (65.67%), Postives = 184/233 (78.97%), Query Frame = 3
Query:   12 DKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAMISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTTLYGSRTVFFLTPDNTLRPLAIELTRPPMDDKPLWRKVYTPGSWNS---TKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSPGD 701
            DK  WFRDEEFARQTLAG+NP SIQL+TE P+ S LD   YGP   +S ITK++IEK++  +++ EEA+ QKKLFMLDYHDL LPYV +VRKL++ T+YGSRT+FFL  D TLRP+AIELTRP    K  WRKV+TPGS  S   T +W W+LAK HVL+HD+GYHQLVSHWLR+HC VEPY+IA NRQLS MHPIYRLLHPH R+T+E+NA    +LI A G+I  TFSPG+
Sbjct:  420 DKLAWFRDEEFARQTLAGMNPLSIQLVTELPIVSKLDELKYGPA--DSLITKELIEKQINRIMTAEEAVAQKKLFMLDYHDLLLPYVHRVRKLDNKTMYGSRTLFFLADDGTLRPIAIELTRPKSPHKQQWRKVFTPGSGYSGSVTGSWEWQLAKIHVLSHDTGYHQLVSHWLRTHCCVEPYVIAANRQLSQMHPIYRLLHPHFRFTMEINAQARGMLICADGIIEKTFSPGE 650          

HSP 2 Score: 37.3502 bits (85), Expect = 6.792e-91
Identity = 15/25 (60.00%), Postives = 19/25 (76.00%), Query Frame = 2
Query:  701 YCMEMRSGIYDKQWRFDEQALPKTL 775
            + ME+ S  YDKQWRFD +ALP+ L
Sbjct:  651 FSMEISSAAYDKQWRFDMEALPEDL 675          
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOX21_HORVU (Lipoxygenase 2.1, chloroplastic OS=Hordeum vulgare GN=LOX2.1 PE=1 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 2.038e-87
Identity = 161/284 (56.69%), Postives = 201/284 (70.77%), Query Frame = 3
Query:   12 DKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAMISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTTLYGSRTVFFLTPDNTLRPLAIELTRPPMDDKPLWRKVYTPGSWNS-TKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSPGDIVWR*GLVSMISNGDLTNKHSPRP-YERGMAVGNQMXXXXXXXXXXXXCQDGL 857
            DKF WFRDEEFARQT+AG+NP SIQL+TE+P+KS+LD   YGP   +S ITK+++E+++  +++ +EA++ KKLFMLDYHDL LPYV KVRKL+ TTLYGSR +FFLT D TLRP+AIELTRP    KP WR+V+TPG   S T +WLW+LAKAH+LAHD+G HQLVSHWLR+H   EPYIIA NRQLS MHP+YRLLHPH R+T+E+NA    +LI+AGG+I  +F PG+       V+         +  P     RGMAV N                DGL
Sbjct:  421 DKFAWFRDEEFARQTIAGMNPMSIQLVTEFPIKSNLDEATYGPA--DSLITKEVVEEQIRRVMTADEAVQNKKLFMLDYHDLLLPYVHKVRKLDGTTLYGSRALFFLTADGTLRPIAIELTRPKSKKKPQWRQVFTPGCDGSVTGSWLWQLAKAHILAHDAGVHQLVSHWLRTHACTEPYIIAANRQLSQMHPVYRLLHPHFRFTMEINAQARAMLINAGGIIEGSFVPGEYSLELSSVAYDQQWRFDMEALPEDLIRRGMAVRNPNGELELAIEDYPYANDGL 702          
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 5.714e-87
Identity = 147/229 (64.19%), Postives = 186/229 (81.22%), Query Frame = 3
Query:   12 DKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAMISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTTLYGSRTVFFLTPDNTLRPLAIELTRPPMDDKPLWRKVYTPGSWNSTKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSPG 698
            D+F WFRDEEFARQTLAGLNP  I+ +TE+P+ S LDP +YGP   ES ++K+I+EK +   ++VEEA+E+K+LF+LDYHD+FLPYV +VR+L  TTLYGSRTVFFL+ + TL PLAIELTRP    KP W++ +T GS ++T++WLW+LAKAHVL HD+GYHQLVSHWLR+H  VEPYIIATNRQLS MHP+YRLLHPH RYT+E+NA+  + LI+A G+I   F  G
Sbjct:  392 DRFSWFRDEEFARQTLAGLNPICIRRLTEFPIVSKLDPAVYGPA--ESALSKEILEKMMNGRMTVEEAMEKKRLFLLDYHDVFLPYVHRVRELPDTTLYGSRTVFFLSDEGTLMPLAIELTRPQSPTKPQWKRAFTHGS-DATESWLWKLAKAHVLTHDTGYHQLVSHWLRTHACVEPYIIATNRQLSRMHPVYRLLHPHFRYTMEINALAREALINADGIIEEAFLAG 617          

HSP 2 Score: 27.7202 bits (60), Expect = 5.714e-87
Identity = 11/29 (37.93%), Postives = 18/29 (62.07%), Query Frame = 2
Query:  689 LTWRYCMEMRSGIYDKQWRFDEQALPKTL 775
            L  +Y +E+ S  Y   W+F+ +ALP+ L
Sbjct:  615 LAGKYSIELSSVAYGAAWQFNTEALPEDL 643          
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOX2_ARATH (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana GN=LOX2 PE=1 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 2.158e-86
Identity = 142/229 (62.01%), Postives = 180/229 (78.60%), Query Frame = 3
Query:   12 DKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAMISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTTLYGSRTVFFLTPDNTLRPLAIELTRPPMDDKPLWRKVYTPGSWNSTKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSPG 698
            D+F W RD+EFARQTLAGLNP SIQL+ EWPL S LDP +YG     S IT +I+E+E+   ++V+EA++ K+LF+LDYHDL LPYV KVR+L +TTLY SRT+FFL+ D+TLRP+AIELT PP  +KP W++V+TPG +++T  WLW LAK H ++HD+GYHQL+SHWLR+H   EPYIIA NRQLS MHPIYRLLHPH RYT+E+NA     L++ GG+I   F PG
Sbjct:  390 DRFSWLRDDEFARQTLAGLNPYSIQLVEEWPLISKLDPAVYGD--PTSLITWEIVEREVKGNMTVDEALKNKRLFVLDYHDLLLPYVNKVRELNNTTLYASRTLFFLSDDSTLRPVAIELTCPPNINKPQWKQVFTPG-YDATSCWLWNLAKTHAISHDAGYHQLISHWLRTHACTEPYIIAANRQLSAMHPIYRLLHPHFRYTMEINARARQSLVNGGGIIETCFWPG 615          

HSP 2 Score: 34.6538 bits (78), Expect = 2.158e-86
Identity = 12/26 (46.15%), Postives = 18/26 (69.23%), Query Frame = 2
Query:  698 RYCMEMRSGIYDKQWRFDEQALPKTL 775
            +Y +E+ S +Y K WRFD++ LP  L
Sbjct:  616 KYALELSSAVYGKLWRFDQEGLPADL 641          
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOX6_ARATH (Lipoxygenase 6, choloroplastic OS=Arabidopsis thaliana GN=LOX6 PE=1 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.381e-70
Identity = 123/232 (53.02%), Postives = 174/232 (75.00%), Query Frame = 3
Query:   12 DKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAM-ISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTT--LYGSRTVFFLTPDNTLRPLAIELTRPPMDDKPLWRKVYTPGSWNSTKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSPG 698
            D+F W RD EF RQ LAG+NP +I+L+ E P++S+LDP +YGP  QES +T++II +E+     ++E+A+E+K+LF++DYHD+ LP+VEK+  ++      Y SRT+FF + +  LRPLAIEL+ PP  +    + VYT G  ++T  W+W+LAKAHV ++D+G HQLV+HWLR+H  +EPYIIATNRQLS MHP+Y+LLHPH+RYTLE+NA     LI+ GG+I + F+PG
Sbjct:  409 DRFAWLRDNEFGRQALAGVNPVNIELLKELPIRSNLDPALYGP--QESVLTEEIIAREVEHYGTTIEKALEEKRLFLVDYHDILLPFVEKINSIKEDPRKTYASRTIFFYSKNGALRPLAIELSLPPTAESEN-KFVYTHGH-DATTHWIWKLAKAHVCSNDAGVHQLVNHWLRTHASMEPYIIATNRQLSTMHPVYKLLHPHMRYTLEINARARKSLINGGGIIESCFTPG 636          

HSP 2 Score: 31.5722 bits (70), Expect = 1.381e-70
Identity = 12/26 (46.15%), Postives = 15/26 (57.69%), Query Frame = 2
Query:  698 RYCMEMRSGIYDKQWRFDEQALPKTL 775
            +Y ME+ S  Y   WRFD + LP  L
Sbjct:  637 KYAMELSSAAYKSMWRFDMEGLPADL 662          
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOX5_ORYSJ (Putative lipoxygenase 5 OS=Oryza sativa subsp. japonica GN=Os04g0447100 PE=3 SV=2)

HSP 1 Score: 250.751 bits (639), Expect = 6.196e-68
Identity = 120/234 (51.28%), Postives = 172/234 (73.50%), Query Frame = 3
Query:    6 RPDKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAMISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTTLYGSRTVFFLTPDNTLRPLAIELTRPPMDDK-PLWRKVYTPGSWNSTKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSPGDI 704
            + DKF W RD+EFARQ LAG+NP +I+ +  +P  S LDP +YGP   ES IT++ I   L  M SV+EA+E  +L+MLDYHD+FLP+++++   +    YG+R VFFLT   TL+P+AIEL  PPM D     ++V+TP + ++T  WLW+LAKAHV ++D+G HQL++HWLR+H  +EP+IIA +RQ+S MHPI++LL PH+RYTL++NA+   ILI+  GVI + F+PG++
Sbjct:  393 KKDKFAWLRDDEFARQALAGINPVNIERLQAFPPVSKLDPAVYGP--PESAITEEHIIGHLDGM-SVQEAVEGSRLYMLDYHDIFLPFLDRINAQDGRKAYGTRAVFFLTAAGTLKPIAIELCLPPMTDGCKRAKRVFTPPA-DATSNWLWQLAKAHVCSNDAGVHQLINHWLRTHACMEPFIIAAHRQMSAMHPIFKLLKPHMRYTLKINALARQILINGDGVIESGFTPGNV 622          

HSP 2 Score: 28.8758 bits (63), Expect = 6.196e-68
Identity = 11/24 (45.83%), Postives = 15/24 (62.50%), Query Frame = 2
Query:  704 CMEMRSGIYDKQWRFDEQALPKTL 775
            CMEM +  Y + WR D++ LP  L
Sbjct:  623 CMEMSAFAYRELWRLDQEGLPADL 646          
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOX3_ARATH (Lipoxygenase 3, chloroplastic OS=Arabidopsis thaliana GN=LOX3 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 4.331e-66
Identity = 118/229 (51.53%), Postives = 166/229 (72.49%), Query Frame = 3
Query:   12 DKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAMISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTTLYGSRTVFFLTPDNTLRPLAIELTRPPMDDKPLWRKVYTPGSWNSTKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSPG 698
            DK  W RD+EFARQ +AG+NP +I+ +  +P  S+LDPKIYGP  Q S +T D I   L    SV++A+E+ +L+MLDYHD+FLP+++++  L+    Y +RT+FFLT   TL+P+AIEL+ PP   K   ++V TP   ++T  W+W+LAKAHV ++D+G HQLV+HWLR+H  +EP+I+A +RQLS MHPI++LL PH+RYTLE+NA+    LISA GVI   F+ G
Sbjct:  415 DKNAWLRDDEFARQAIAGINPVNIERVKTFPPVSNLDPKIYGP--QHSALTDDHIIGHLDGF-SVQQALEENRLYMLDYHDIFLPFLDRINALDGRKAYATRTIFFLTRLGTLKPVAIELSLPPHGPKHRSKRVLTPPV-DATSNWMWQLAKAHVSSNDAGVHQLVNHWLRTHACLEPFILAAHRQLSAMHPIFKLLDPHMRYTLEINALARQSLISADGVIEGGFTAG 639          

HSP 2 Score: 29.6462 bits (65), Expect = 4.331e-66
Identity = 12/25 (48.00%), Postives = 14/25 (56.00%), Query Frame = 2
Query:  701 YCMEMRSGIYDKQWRFDEQALPKTL 775
            Y MEM +  Y   WRFD + LP  L
Sbjct:  641 YGMEMSAAAYKSSWRFDMEGLPADL 665          
BLAST of EY664694 vs. ExPASy Swiss-Prot
Match: LOX4_ARATH (Lipoxygenase 4, chloroplastic OS=Arabidopsis thaliana GN=LOX4 PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 6.708e-64
Identity = 111/229 (48.47%), Postives = 164/229 (71.62%), Query Frame = 3
Query:   12 DKFFWFRDEEFARQTLAGLNPCSIQLITEWPLKSSLDPKIYGPRLQESEITKDIIEKELGAMISVEEAIEQKKLFMLDYHDLFLPYVEKVRKLEHTTLYGSRTVFFLTPDNTLRPLAIELTRPPMDDKPLWRKVYTPGSWNSTKTWLWRLAKAHVLAHDSGYHQLVSHWLRSHCVVEPYIIATNRQLSVMHPIYRLLHPHLRYTLELNAIGSDILISAGGVIXNTFSPG 698
            DK+ W RD+EFARQ +AG+NP +I+ +T +P  S+LDP+IYGP L  S +T+D I  +L  + +V++A+E  +LFM+DYHD++LP+++++  L+    Y +RT+ FLT   TL+P+AIEL+ P         K       ++T  W+W+LAKAHV ++D+G HQLV+HWLR+H  +EP+I+A +RQLS MHPI++LL PH+RYTLE+NA+    LISA GVI + F+ G
Sbjct:  420 DKYAWLRDDEFARQAIAGINPVNIERVTSYPPVSNLDPEIYGPGLH-SALTEDHIIGQLDGL-TVQQALETNRLFMVDYHDIYLPFLDRINALDGRKAYATRTILFLTRLGTLKPIAIELSLPSQSSSNQKSKRVVTPPVDATSNWMWQLAKAHVGSNDAGVHQLVNHWLRTHACLEPFILAAHRQLSAMHPIFKLLDPHMRYTLEINAVARQTLISADGVIESCFTAG 646          

HSP 2 Score: 28.8758 bits (63), Expect = 6.708e-64
Identity = 11/26 (42.31%), Postives = 16/26 (61.54%), Query Frame = 2
Query:  698 RYCMEMRSGIYDKQWRFDEQALPKTL 775
            +Y +E+ S  Y  +WRFD + LP  L
Sbjct:  647 QYGLEISSAAYKNKWRFDMEGLPADL 672          
The following BLAST results are available for this feature:
BLAST of EY664694 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 57
Match NameE-valueIdentityDescription
LOXC2_ORYSJ9.654e-9365.35Probable lipoxygenase 8, chloroplastic OS=Oryza sa... [more]
LOXC1_ORYSJ4.759e-9264.91Lipoxygenase 7, chloroplastic OS=Oryza sativa subs... [more]
LOX22_HORVU6.792e-9165.67Lipoxygenase 2.2, chloroplastic OS=Hordeum vulgare... [more]
LOX21_HORVU2.038e-8756.69Lipoxygenase 2.1, chloroplastic OS=Hordeum vulgare... [more]
LOX23_HORVU5.714e-8764.19Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare... [more]
LOX2_ARATH2.158e-8662.01Lipoxygenase 2, chloroplastic OS=Arabidopsis thali... [more]
LOX6_ARATH1.381e-7053.02Lipoxygenase 6, choloroplastic OS=Arabidopsis thal... [more]
LOX5_ORYSJ6.196e-6851.28Putative lipoxygenase 5 OS=Oryza sativa subsp. jap... [more]
LOX3_ARATH4.331e-6651.53Lipoxygenase 3, chloroplastic OS=Arabidopsis thali... [more]
LOX4_ARATH6.708e-6448.47Lipoxygenase 4, chloroplastic OS=Arabidopsis thali... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-069-D04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY664694 ID=EY664694; Name=EY664694; organism=Citrus sinensis; type=EST; length=862bp
CCACGCGTCCGGACAAATTCTTTTGGTTTAGGGATGAGGAATTTGCTAGG
CAAACACTAGCTGGTCTCAACCCATGCAGCATACAGTTGATTACGGAATG
GCCTTTGAAAAGCTCACTCGATCCTAAAATCTACGGTCCACGACTACAAG
AATCAGAAATCACCAAAGATATCATTGAAAAAGAACTTGGAGCAATGATT
TCTGTTGAAGAGGCTATAGAACAAAAGAAGTTGTTCATGTTAGATTACCA
TGACCTATTTCTGCCCTATGTAGAAAAAGTGAGGAAGCTCGAACACACGA
CCTTGTATGGGTCCCGCACTGTATTCTTCCTAACTCCAGATAACACGTTG
AGACCACTAGCCATTGAGTTAACTCGGCCACCAATGGACGACAAGCCACT
TTGGAGAAAAGTGTATACACCGGGTTCTTGGAATTCAACTAAGACCTGGC
TTTGGAGGCTAGCCAAAGCTCATGTTCTTGCTCATGATTCGGGCTATCAC
CAGCTTGTCAGCCATTGGTTAAGAAGTCATTGTGTGGTAGAACCTTACAT
AATTGCTACCAATCGACAACTCAGTGTGATGCATCCAATCTATAGATTGT
TGCATCCTCATCTTCGATACACATTGGAGCTCAATGCTATAGGGTCGGAT
ATACTTATTAGTGCTGGTGGAGTCATTGNAAACACATTCTCACCTGGAGA
TATTGTATGGAGATGAGGTCTGGTATCTATGATAAGCAATGGCGATTTGA
CGAACAAGCACTCCCCAAGACCTTATGAGAGGGGAATGGCCGTTGGAAAC
CAAATGCTCGACACGCTAAAGCTAACATTGACGACTATTCTTTGCCAGGA
CGGGCTCGATCT
back to top