EY664678

Overview
NameEY664678
Unique NameEY664678
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7950 contig Csv1_Contig7950:1..879. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_ARATH (Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabidopsis thaliana GN=NCS6 PE=2 SV=2)

HSP 1 Score: 245.743 bits (626), Expect = 1.260e-72
Identity = 124/161 (77.02%), Postives = 139/161 (86.34%), Query Frame = 3
Query:  414 ECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKI-----ARDIMQMILXKTVY*HIAR 881
            ECFYEVFEEEIHQVIV N+LFK+GER+AIGASGGKDSTVLA+VLSELNRRHNYGLDLFLLSIDEGI+GY DDSL+TVKRNE+QYGLPLKIVS +DLYGWTMDEIVK+I  K+NCTFCGVFRRQ LDRGA+LL V K+     A DI + +L   +   IAR
Sbjct:   36 ECFYEVFEEEIHQVIVQNRLFKSGERVAIGASGGKDSTVLAYVLSELNRRHNYGLDLFLLSIDEGITGYRDDSLETVKRNEVQYGLPLKIVSYKDLYGWTMDEIVKMIGLKNNCTFCGVFRRQALDRGAALLKVEKLVTGHNADDIAETVLLNILRGDIAR 196          

HSP 2 Score: 47.7506 bits (112), Expect = 1.260e-72
Identity = 23/37 (62.16%), Postives = 27/37 (72.97%), Query Frame = 2
Query:  314 ESKSKKA-GGRLCSTCNQRKAALKRPKTLEQICRGVF 421
            E+K+KKA   RLC  CN R+  LKRPKTL+QICR  F
Sbjct:    2 EAKNKKAVASRLCCLCNLRRPVLKRPKTLQQICRECF 38          
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_ORYSJ (Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza sativa subsp. japonica GN=NCS6 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 5.660e-70
Identity = 118/161 (73.29%), Postives = 132/161 (81.99%), Query Frame = 3
Query:  414 ECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKI-----ARDIMQMILXKTVY*HIAR 881
            ECFY VFE+EIHQ IV N LFK G+R+AIGASGGKDSTVLA+VLSELNRRH Y LDLFLLS+DEGI+GY DDSL+TVKRNEIQYGLPLKIVS +DLYGWTMD+IVK I  K+NCTFCGVFRRQ LDRGA+LL V KI     A DI + +L   +   IAR
Sbjct:   42 ECFYVVFEDEIHQTIVDNNLFKPGDRVAIGASGGKDSTVLAYVLSELNRRHKYCLDLFLLSVDEGITGYRDDSLETVKRNEIQYGLPLKIVSYKDLYGWTMDDIVKAIGLKNNCTFCGVFRRQALDRGAALLKVDKIVTGHNADDIAETVLLNILRGDIAR 202          

HSP 2 Score: 52.7582 bits (125), Expect = 5.660e-70
Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 2
Query:  329 KAGGRLCSTCNQRKAALKRPKTLEQICRGVF 421
            +AG RLC+ C +RKAALKRPKTLEQICR  F
Sbjct:   14 RAGSRLCTRCGERKAALKRPKTLEQICRECF 44          
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_CHLRE (Cytoplasmic tRNA 2-thiolation protein 1 OS=Chlamydomonas reinhardtii GN=NCS6 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.604e-60
Identity = 106/157 (67.52%), Postives = 125/157 (79.62%), Query Frame = 3
Query:  414 ECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKIARDIMQMILXKTVY*HIARG 884
            ECF+  FEEE+HQ IV N+LFK GER+A+ ASGGKDSTVLA ++S LN R+NYGLDLFLLSIDEGI+GY DDSL+TVKRNE QYG+PLK+VS ++LYGWTMDEIV  I  K+NCTFCGVFRRQ LDRGA L+   KIA       + +TV  +I RG
Sbjct:   28 ECFFTAFEEEVHQTIVDNKLFKHGERLAVAASGGKDSTVLAHIMSTLNARYNYGLDLFLLSIDEGITGYRDDSLETVKRNEQQYGIPLKVVSYKELYGWTMDEIVSQIGTKNNCTFCGVFRRQALDRGAVLMGANKIATGHNADDVAETVLLNILRG 184          

HSP 2 Score: 38.1206 bits (87), Expect = 1.604e-60
Identity = 16/27 (59.26%), Postives = 18/27 (66.67%), Query Frame = 2
Query:  341 RLCSTCNQRKAALKRPKTLEQICRGVF 421
            RLC  CN  +A L RPKT EQ+CR  F
Sbjct:    4 RLCVRCNTSRAMLNRPKTQEQVCRECF 30          
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_DICDI (Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyostelium discoideum GN=ctu1 PE=2 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 7.794e-57
Identity = 99/157 (63.06%), Postives = 123/157 (78.34%), Query Frame = 3
Query:  414 ECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKIARDIMQMILXKTVY*HIARG 884
            ECFY VFE+EIH  I+ N LFK G+R+AIGASGGKDSTVLA +++ LN++++YGLDLFLLSIDEGI+GY DDSL+TVKRN+ QY +PLKI+S ++LY WTMD+IVK I  K NCTFCGVFRRQ LDRGA +L   KI        + +TV  ++ RG
Sbjct:   35 ECFYTVFEDEIHHTIISNNLFKRGDRVAIGASGGKDSTVLAEIMTLLNKKYDYGLDLFLLSIDEGITGYRDDSLETVKRNQEQYQIPLKILSYKELYNWTMDDIVKEIGLKGNCTFCGVFRRQALDRGAVMLKANKIVTGHNADDIAETVLMNLLRG 191          

HSP 2 Score: 37.3502 bits (85), Expect = 7.794e-57
Identity = 16/36 (44.44%), Postives = 21/36 (58.33%), Query Frame = 2
Query:  314 ESKSKKAGGRLCSTCNQRKAALKRPKTLEQICRGVF 421
            E+ + K   +LC  CN  +  LKRPKT E IC+  F
Sbjct:    2 ENTATKKKSKLCEVCNVSRPVLKRPKTGEMICKECF 37          
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_USTMA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Ustilago maydis GN=NCS6 PE=3 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.498e-56
Identity = 100/161 (62.11%), Postives = 121/161 (75.16%), Query Frame = 3
Query:  414 ECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKI-----ARDIMQMILXKTVY*HIAR 881
            ECF+ VFE E+H  IV N LFK G+R+AIGASGGKDSTVLA  +  LN R++YGLDLFLLSIDEGI+GY DDSL+TVKRN+ QY LPLK++   +LYGWTMD+IVK +  K+NCTFCGVFRRQ LDRGA+ L V  I     A D+ + +L   +   IAR
Sbjct:   28 ECFFYVFETEVHHTIVSNNLFKRGDRVAIGASGGKDSTVLAHCMKVLNERYDYGLDLFLLSIDEGITGYRDDSLETVKRNQQQYQLPLKVLGYGELYGWTMDDIVKSVGRKNNCTFCGVFRRQALDRGAAALGVDHIVTGHNADDVAETVLMNVLRGDIAR 188          

HSP 2 Score: 36.965 bits (84), Expect = 6.498e-56
Identity = 14/27 (51.85%), Postives = 19/27 (70.37%), Query Frame = 2
Query:  341 RLCSTCNQRKAALKRPKTLEQICRGVF 421
            +LC  CN  +A L+RPKT +QIC+  F
Sbjct:    4 KLCVICNAERAVLRRPKTAQQICKECF 30          
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_XENTR (Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus tropicalis GN=ctu1 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.442e-55
Identity = 103/161 (63.98%), Postives = 121/161 (75.16%), Query Frame = 3
Query:  414 ECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKI-----ARDIMQMILXKTVY*HIAR 881
            +CF+  FEEEIH  IV  +LF  GE++ IGASGGKDSTVLA VL  LN R+ YGLDL L+S+DEGISGY DDSL+TVKRN+ QY LPLKIVS Q+LYGWTMD+IVK +  K+NCTFCGVFRRQ LDRGA +L V KI     A DI + +L   +   IAR
Sbjct:   27 DCFFHAFEEEIHHTIVSAKLFNPGEKVGIGASGGKDSTVLAHVLKVLNERYAYGLDLILVSVDEGISGYRDDSLETVKRNQQQYELPLKIVSYQELYGWTMDQIVKQVGLKNNCTFCGVFRRQALDRGAMMLGVNKICTGHNADDIAETVLMNFLRGDIAR 187          

HSP 2 Score: 34.2686 bits (77), Expect = 1.442e-55
Identity = 12/25 (48.00%), Postives = 18/25 (72.00%), Query Frame = 2
Query:  347 CSTCNQRKAALKRPKTLEQICRGVF 421
            CS+C +R+A L+RPKT   +C+  F
Sbjct:    5 CSSCEERRAVLRRPKTGHSLCKDCF 29          
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_CRYNE (Cytoplasmic tRNA 2-thiolation protein 1 OS=Cryptococcus neoformans GN=NCS6 PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 2.449e-55
Identity = 103/162 (63.58%), Postives = 127/162 (78.40%), Query Frame = 3
Query:  414 ECFYEVFEEEIHQVIV-GNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKI-----ARDIMQMILXKTVY*HIAR 881
            +CF+EVFE E+H  IV G  +FK GER+AIGASGGKDSTVLA VLS LN+R++YGLDL+LLSIDEGI+GY DDSL+TVK+N+ +YGLPLKI+S  +LYGWTMD+IV+ +  K+NCTFCGVFRRQ LDRGA+ L V  I     A DI + +L   +   IAR
Sbjct:   28 DCFFEVFETEVHNTIVEGEGIFKRGERVAIGASGGKDSTVLAHVLSVLNKRYDYGLDLYLLSIDEGITGYRDDSLETVKQNQAEYGLPLKILSYSELYGWTMDKIVEQVGKKNNCTFCGVFRRQALDRGAAQLGVDHIVTGHNADDIAETVLMNIMRGDIAR 189          

HSP 2 Score: 33.113 bits (74), Expect = 2.449e-55
Identity = 12/25 (48.00%), Postives = 18/25 (72.00%), Query Frame = 2
Query:  347 CSTCNQRKAALKRPKTLEQICRGVF 421
            CS C+  +A +KRPKT +Q+C+  F
Sbjct:    6 CSLCHTARALVKRPKTGQQVCKDCF 30          
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_ASHGO (Cytoplasmic tRNA 2-thiolation protein 1 OS=Ashbya gossypii GN=NCS6 PE=3 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 4.161e-55
Identity = 95/156 (60.90%), Postives = 119/156 (76.28%), Query Frame = 3
Query:  417 CFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKIARDIMQMILXKTVY*HIARG 884
            CF+ VFE EIH  I+ N+LF+ GER+A+GASGGKDSTVLA++L  LN RH+YGL++ LLSIDEGI GY DDSL TVKRN+ QYGLPLKIVS +DLY WTMDEIV     +++CT+CGVFRRQ LDRGA++L +  +        + +TV  +I RG
Sbjct:   43 CFFHVFETEIHNTIMENKLFQRGERVAVGASGGKDSTVLAYILKLLNERHDYGLEIVLLSIDEGIVGYRDDSLATVKRNQEQYGLPLKIVSYKDLYDWTMDEIVACAGMRNSCTYCGVFRRQALDRGAAMLDIHHVVTGHNADDMAETVLMNILRG 198          

HSP 2 Score: 39.2762 bits (90), Expect = 4.161e-55
Identity = 15/33 (45.45%), Postives = 23/33 (69.70%), Query Frame = 2
Query:  323 SKKAGGRLCSTCNQRKAALKRPKTLEQICRGVF 421
            +K   G+LC  C+ RKA +KRPK L+++C+  F
Sbjct:   12 AKVTAGQLCELCHARKALVKRPKNLQKVCKLCF 44          
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_LACBS (Cytoplasmic tRNA 2-thiolation protein 1 OS=Laccaria bicolor (strain S238N-H82) GN=NCS6 PE=3 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.202e-54
Identity = 101/165 (61.21%), Postives = 122/165 (73.94%), Query Frame = 3
Query:  414 ECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKI-----ARDIMQMILXKTVY*HIAR-GYC 890
            ECF+ VFE E+H  I    LFK G+R+AIGASGGKDSTVLA+V+  LN R+ YGL+LFLLSIDEGI+GY DDSL+TVKRN+ QY +PLKI+S  +LYGWTMD IV  +  K+NCTFCGVFRRQ LDRGA++L V  I     A DI + +L   +   IAR G C
Sbjct:   28 ECFFYVFETEVHNTITQANLFKPGDRVAIGASGGKDSTVLAYVMKMLNERYQYGLELFLLSIDEGITGYRDDSLETVKRNQQQYDMPLKILSYDELYGWTMDAIVSQVGRKNNCTFCGVFRRQALDRGAAMLNVDHIVTGHNADDIAETVLMNIMRGDIARLGRC 192          

HSP 2 Score: 35.8094 bits (81), Expect = 1.202e-54
Identity = 15/25 (60.00%), Postives = 18/25 (72.00%), Query Frame = 2
Query:  347 CSTCNQRKAALKRPKTLEQICRGVF 421
            C+ C + KA +KRPKT EQICR  F
Sbjct:    6 CAICQKAKAMVKRPKTGEQICRECF 30          
BLAST of EY664678 vs. ExPASy Swiss-Prot
Match: CTU1_KLULA (Cytoplasmic tRNA 2-thiolation protein 1 OS=Kluyveromyces lactis GN=NCS6 PE=3 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 3.471e-54
Identity = 97/161 (60.25%), Postives = 118/161 (73.29%), Query Frame = 3
Query:  402 RYVGECFYEVFEEEIHQVIVGNQLFKAGERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYXDDSLQTVKRNEIQYGLPLKIVSLQDLYGWTMDEIVKVIRXKDNCTFCGVFRRQPLDRGASLLXVXKIARDIMQMILXKTVY*HIARG 884
            R   ECF+ VFE EIH  IV N LF  GERIA+GASGGKDSTVLA+VL  LN RH+YG+++ LLSIDEGI GY DDSL TVKRN++QY LPL+IVS +DLY WTMDEIV     +++CT+CGVFRRQ LDRGA+ L +  +        + +TV  +I RG
Sbjct:   38 RICKECFFSVFETEIHNTIVSNNLFHRGERIAVGASGGKDSTVLAYVLKLLNDRHDYGVEIVLLSIDEGIVGYRDDSLATVKRNQVQYDLPLEIVSYKDLYNWTMDEIVACAGIRNSCTYCGVFRRQALDRGAAKLGIKHVVTGHNADDMAETVLMNILRG 198          

HSP 2 Score: 37.3502 bits (85), Expect = 3.471e-54
Identity = 14/27 (51.85%), Postives = 20/27 (74.07%), Query Frame = 2
Query:  341 RLCSTCNQRKAALKRPKTLEQICRGVF 421
            +LC  C+ RKA +KRPK L++IC+  F
Sbjct:   18 QLCELCHARKAVMKRPKNLQRICKECF 44          
The following BLAST results are available for this feature:
BLAST of EY664678 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
CTU1_ARATH1.260e-7277.02Cytoplasmic tRNA 2-thiolation protein 1 OS=Arabido... [more]
CTU1_ORYSJ5.660e-7073.29Cytoplasmic tRNA 2-thiolation protein 1 OS=Oryza s... [more]
CTU1_CHLRE1.604e-6067.52Cytoplasmic tRNA 2-thiolation protein 1 OS=Chlamyd... [more]
CTU1_DICDI7.794e-5763.06Cytoplasmic tRNA 2-thiolation protein 1 OS=Dictyos... [more]
CTU1_USTMA6.498e-5662.11Cytoplasmic tRNA 2-thiolation protein 1 OS=Ustilag... [more]
CTU1_XENTR1.442e-5563.98Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus... [more]
CTU1_CRYNE2.449e-5563.58Cytoplasmic tRNA 2-thiolation protein 1 OS=Cryptoc... [more]
CTU1_ASHGO4.161e-5560.90Cytoplasmic tRNA 2-thiolation protein 1 OS=Ashbya ... [more]
CTU1_LACBS1.202e-5461.21Cytoplasmic tRNA 2-thiolation protein 1 OS=Laccari... [more]
CTU1_KLULA3.471e-5460.25Cytoplasmic tRNA 2-thiolation protein 1 OS=Kluyver... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-069-B12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY664678 ID=EY664678; Name=EY664678; organism=Citrus sinensis; type=EST; length=901bp
CCACGCGTCCGANAGAAAATAGGTTTCGTCTATTTGTCCAATTGATTGTC
CTTAATTGTAATTTAGTTAAGGATATTATGGTAATAAAAGAAGTTTAGGG
AATGAGAAGGTCCAGAGACTTTGGAGGGGTGAGGGTGCCGGTCGGACCGC
TGCTTTCATAACAGTTCCATTCCGAGAAGCTGTTGCCGCACTGCAAAAGC
AAACTCAAATCTTCAATTTTTCCCTCATAACCCAAACTTGATCTCTTGTA
AGTCTGTTAGCTTGTCTCTTCATAGTTTACTTAGTGGGCCATTAACCGTC
AATGGAGGTCGCCGAGTCGAAGTCCAAGAAGGCCGGTGGCCGCCTTTGTT
CCACCTGTAACCAGAGAAAGGCTGCCCTCAAACGACCTAAAACCCTAGAA
CAGATATGTAGGGGAGTGTTTCTATGAGGTATTTGAGGAGGAGATCCACC
AAGTCATTGTGGGCAATCAGCTATTCAAGGCTGGTGAGCGTATTGCCATC
GGCGCCTCTGGTGGAAAAGATTCCACTGTCCTTGCTTTTGTGTTGTCAGA
GCTGAACCGGCGTCACAACTATGGCCTTGATCTTTTCCTCCTATCAATTG
ATGAAGGCATTTCAGGATACANGGATGATTCACTTCAAACTGTCAAAAGA
AATGAAATTCAGTATGGTCTGCCACTGAAGATTGTTTCATTACAGGATTT
ATATGGATGGACAATGGATGAAATAGTGAAGGTGATTCGGNTTAAAGATA
ATTGCACCTTTTGTGGTGTTTTTCGTCGCCAGCCCCTTGATCGAGGTGCT
TCATTGTTGAANGTANACAAGATTGCACGGGACATAATGCAGATGATATT
GCANAAAACTGTCTATTGACATATTGCGAGGGGATATTGCTTNATTGAAT
A
back to top