EY664666

Overview
NameEY664666
Unique NameEY664666
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length928
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6303 contig Csv1_Contig6303:240..1167. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH30_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 30 OS=Arabidopsis thaliana GN=XTH30 PE=2 SV=2)

HSP 1 Score: 392.119 bits (1006), Expect = 2.343e-108
Identity = 180/282 (63.83%), Postives = 220/282 (78.01%), Query Frame = 3
Query:   12 LIRSPDGKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFPSKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQVPSSNCQDTDSRLAEKGLSVITPXXXXXXXXXXXXXXXXSYCYDTMRYPVPLPECXLXPSETTRFKDTGRXEFGGSHKNHRHXSRRQ 857
            L+RSPD  +VRLLL+R++GSGF+SS +Y HGF+S+MIKLP+D+TAG+ VAFYTSNGDVF KTHDELD EFLGN+ GKPWRFQTN YGNGST RGREERY+LWFDP+K+FHRYSILWT + IIF+VD+VPIREV+R+ AMG D+P+KPM+LY TIWDAS+WATSGGK K NYK+APF +EFK F L+GC VDPI++VP  +C D+   L  +  S I                  SYCYDT+RYP PLPEC + P+E  RFK+TGR +FGG+    R  +RRQ
Sbjct:   45 LVRSPDDLSVRLLLDRYTGSGFISSNMYQHGFYSSMIKLPADYTAGVVVAFYTSNGDVFEKTHDELDIEFLGNIKGKPWRFQTNLYGNGSTHRGREERYRLWFDPSKEFHRYSILWTPHKIIFWVDDVPIREVIRNDAMGADYPAKPMALYATIWDASDWATSGGKYKANYKFAPFVAEFKSFSLDGCSVDPIQEVP-MDCSDSVDFLESQDYSSINSHQRAAMRRFRQRFMYYSYCYDTLRYPEPLPECVIVPAEKDRFKETGRLKFGGTEARERRRNRRQ 325          
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH29_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 29 OS=Arabidopsis thaliana GN=XTH29 PE=2 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 5.232e-100
Identity = 174/301 (57.81%), Postives = 214/301 (71.10%), Query Frame = 3
Query:   12 LIRSPDGKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFPSKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPV----------DPIEQVPSSNCQDTDSRLAEKGLSVITPXXXXXXXXXXXXXXXXSYCYDTMRYPVPLPECXLXPSETTRFKDTGRXEFGGSH-KNHRHXSRRQPGASIPXI 881
            LIRSPD ++VRLLL++++GSGF+SS +Y HGFFS++IKLP  +TAG+ VAFYTSNGDVF K HDELD EFLGN+ GKPWRFQTN YGNGST RGREERY+LWFDP+K+FHRYSILWT   IIF+VD+VPIRE++R + M GD+P KPMSLY TIWDAS+WATSGGK  V+Y ++PF SEFKD  L+GC V          + I    + NC  +D  L     S I+P                SYCYDT+RY VP PEC +  +E  RF+DTGR +FGGSH K H+   +R+   S P +
Sbjct:   53 LIRSPDDRSVRLLLDKYTGSGFISSSMYQHGFFSSLIKLPGAYTAGIVVAFYTSNGDVFVKDHDELDIEFLGNLEGKPWRFQTNMYGNGSTNRGREERYRLWFDPSKEFHRYSILWTPTKIIFWVDDVPIREILRKEEMNGDYPQKPMSLYATIWDASSWATSGGKFGVDYTFSPFVSEFKDIALDGCNVSDSFPGENNNNNIGNYNNINCSVSDQFLMSNDYSTISPKQATAMRRFRERYMYYSYCYDTIRYSVPPPECVIVTAEKNRFRDTGRLKFGGSHPKVHKARKKRRRNRSTPVV 353          
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH27_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 27 OS=Arabidopsis thaliana GN=XTH27 PE=2 SV=2)

HSP 1 Score: 331.257 bits (848), Expect = 4.908e-90
Identity = 165/282 (58.51%), Postives = 194/282 (68.79%), Query Frame = 3
Query:   27 DGKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFPSKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQVPSSNCQD---TDSRLAEKGLSVITPXXXXXXXXXXXXXXXXSYCYDTMRYPVPLPECXLXPSETTRFKDTGRXEFGG---SHKNHRHXSRR 854
            DGK+VRL L+  +GSGFVS+  Y HGFFSA IKLPSD+TAG+ VAFY SNGD++ K HDE+DFEFLGN+  K WR QTN YGNGST  GREERY LWFDPT+ FH+YSILW+ ++IIF+VD VPIREV R+  MGG FPSKPMSLYTTIWD S WAT+GGK  VNYKYAP+ + F D VL GCPVDPIEQ P   C +    D R A++    ITP                SYCYD  RY V L EC + P+E  R +      FGG    H+N +H S+R
Sbjct:   49 DGKSVRLTLDERTGSGFVSNDYYLHGFFSASIKLPSDYTAGVVVAFYMSNGDMYEKNHDEIDFEFLGNIREKEWRVQTNIYGNGSTHSGREERYNLWFDPTEDFHQYSILWSDSHIIFFVDNVPIREVKRTAEMGGHFPSKPMSLYTTIWDGSKWATNGGKYGVNYKYAPYIARFSDLVLHGCPVDPIEQFP--RCDEGAAEDMRAAQE----ITPSQRSKMDVFRRRLMTYSYCYDRARYNVALSECVVNPAEAQRLRVYDPVRFGGIPRRHRNGKHRSKR 324          
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH28_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 28 OS=Arabidopsis thaliana GN=XTH28 PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 2.693e-88
Identity = 162/286 (56.64%), Postives = 198/286 (69.23%), Query Frame = 3
Query:   12 LIRSPDGKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFPSKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQVPSSNCQD---TDSRLAEKGLSVITPXXXXXXXXXXXXXXXXSYCYDTMRYPVPLPECXLXPSETTRFKDTGRXEFGG---SHKNHRHXSR 851
            LI   DGK+VRL L+  +GSGFVS+ +Y HGFFS+ IKLP+D++AG+ +AFY SNGD++ K HDE+DFEFLGN+ G+ WR QTN YGNGST  GREERY LWFDPT+ FH+YSILW+ ++IIFYVD VPIREV R+ +MGGDFP+KPMSLY+TIWD S WAT GGK  VNYKYAP+ S+F D +L GC VDP E+ PS  C+D    + RLA    S IT                 SYCYD MRY V L EC + P+E  R +      FGG    H+  +H SR
Sbjct:   44 LIVHRDGKSVRLTLDERTGSGFVSNDIYLHGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGREWRIQTNIYGNGSTHLGREERYNLWFDPTEDFHQYSILWSLSHIIFYVDNVPIREVKRTASMGGDFPAKPMSLYSTIWDGSKWATDGGKYGVNYKYAPYVSQFTDLILHGCAVDPTEKFPS--CKDEAVQNLRLA----SEITESQRNKMEIFRQKHMTYSYCYDHMRYKVVLSECVVNPAEAKRLRVYDPVTFGGIPHGHRRGKHRSR 323          
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH33_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 33 OS=Arabidopsis thaliana GN=XTH33 PE=2 SV=2)

HSP 1 Score: 218.779 bits (556), Expect = 3.550e-56
Identity = 104/251 (41.43%), Postives = 141/251 (56.18%), Query Frame = 3
Query:   27 DGKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFPSKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQVPSSNCQDTDSRLAE------KGLSVITPXXXXXXXXXXXXXXXXSYCYDTMRYPVPLPEC 761
            +G   +L L++ SG+G VS   Y++GFFSA +KLP+   +G+ VAFY SN + +PK+HDE+D E LG      W  QTN Y NGST  GREE++  WFDPT+ FH Y+++W S++ +F VD +P+R+     A    +PSKPMSLY T+WD S WAT GGK  VNYKYAPF     D  L GC V+      S  C  +   ++       +  + ++                 SYC D  RY V   EC
Sbjct:   59 NGSLAKLTLDKSSGAGLVSKNKYHYGFFSARLKLPAGFASGVVVAFYLSNAETYPKSHDEIDIELLGRSRRDDWTIQTNVYANGSTRTGREEKFYFWFDPTQAFHDYTLIWNSHHTVFLVDNIPVRQFPNRGAFTSAYPSKPMSLYVTVWDGSEWATKGGKYPVNYKYAPFVVSVADVELSGCSVNNGSSTGSGPCTKSGGSISSLDPVDGQDFATLSKNQINAMDWARRKLMFYSYCSDKPRYKVMPAEC 309          
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH2_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 2 OS=Arabidopsis thaliana GN=XTH2 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 2.016e-51
Identity = 109/251 (43.43%), Postives = 142/251 (56.57%), Query Frame = 3
Query:   12 LIRSPDGKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFY-TSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFPSKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQVPSSNCQDTDSRLAEKGLSVITPXXXXXXXXXXXXXXXXSYCYDTMRYPVPLPEC 761
            +++   GK V+L ++  SGSGF S   Y  GFF   IKLP   +AG+  AFY TS GD    THDE+DFEFLGN  GKP   QTN + NG    GRE+++  WFDPT  FH Y ILW    I+FYVD+VPIR     K  G ++PSKPM L  ++W+  NWATSGGK K+N+ YAPF ++++ F   GC V+  +   ++ C  T      +  S ++                  YC D  RYPVP  EC
Sbjct:   45 ILKLNQGKEVQLSMDYSSGSGFESKSHYGSGFFQMRIKLPPRDSAGVVTAFYLTSKGD----THDEVDFEFLGNRQGKPIAIQTNVFSNGQG--GREQKFVPWFDPTTSFHTYGILWNPYQIVFYVDKVPIRVFKNIKKSGVNYPSKPMQLVASLWNGENWATSGGKEKINWAYAPFKAQYQGFSDHGCHVNG-QSNNANVCGSTRYWWNTRTYSQLSANEQKVMENVRAKYMTYDYCSDRPRYPVPPSEC 288          
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH31_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 31 OS=Arabidopsis thaliana GN=XTH31 PE=2 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 7.927e-48
Identity = 102/245 (41.63%), Postives = 139/245 (56.73%), Query Frame = 3
Query:   39 VRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTAR---GREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFPSKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQVPSSNCQ-DTDSRLAEKGLSVITPXXXXXXXXXXXXXXXXSYCYDTMRYPVPLPEC 761
            V L L++ +GSGF S + Y  G+F A IKL    TAG+  + Y SN    P  HDE+D EFLG   GKP+  QTN +  GS  R   GRE ++ LWFDPT+ FH Y+ILW  N I+F+VD+VPIR   R       FP++PM +Y +IWDAS+WAT  G+ K +Y+Y PF +++K+F L GC  D      SS+C+  + + +  +GLS                    +YC+D  R     PEC
Sbjct:   59 VTLWLDKSTGSGFKSLRPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNVFVRGSGDRNVIGREMKFTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYNRKNE--AIFPTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTAD-----SSSSCRPPSPAPMRNRGLS---RQQMAALTWAQRNFLVYNYCHDPKRDHTQTPEC 293          
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH1_SOLLC (Probable xyloglucan endotransglucosylase/hydrolase 1 OS=Solanum lycopersicum GN=XTH1 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 2.550e-46
Identity = 98/245 (40.00%), Postives = 137/245 (55.92%), Query Frame = 3
Query:   30 GKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFP-SKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQVPSSNCQDTDSRLAEKGLSVITPXXXXXXXXXXXXXXXXSYCYDTMRYPVPLPEC 761
            G    L+L+R SG+GF S K Y  G FS  ++L    +AG+  AFY S+ +     HDE+DFEFLGN  G+P+  QTN +  G     RE+R  LWFDPTK +H YS+LW +  I+ +VD+VPIR    SK +G  FP ++PM +Y+++WDA +WAT GG  K N+  APFT+ +  F ++GC     ++V   N +       +K    +                  +YC D  RYPVP PEC
Sbjct:   52 GTTTDLILDRSSGAGFQSKKSYLFGHFSMKMRLVGGDSAGVVTAFYLSSNNA---EHDEIDFEFLGNRTGQPYILQTNVFTGGKG--NREQRIYLWFDPTKGYHSYSVLWNTYLIVIFVDDVPIRAFKNSKDLGVKFPFNQPMKIYSSLWDADDWATRGGLEKTNWANAPFTASYTSFHVDGCEAATPQEVQVCNTKGM-KWWDQKAFQDLDALQYRRLRWVRQKYTVYNYCTDKARYPVPPPEC 290          
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH6_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana GN=XTH6 PE=2 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 4.350e-46
Identity = 100/246 (40.65%), Postives = 143/246 (58.13%), Query Frame = 3
Query:   27 DGKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGSTARGREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFP-SKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGCPVDPIEQVPSSNCQDTDSRLAEKGLSVITPXXXXXXXXXXXXXXXXSYCYDTMRYPVPLPEC 761
            DGK ++L+L++ +G GF S + Y  G  S  IKL    +AG   AFY ++        DELDFEFLGN +G+P+  QTN + +G     RE+R  LWFDP+  +H Y+ILW+  +I+FYVD+VPIRE   ++A    +P S+PM +Y+T+W+A +WAT GG  K+++  APF + +KDF +EGCPV P      SN  +     A + L+ +                   YC D  R+PVP PEC
Sbjct:   53 DGKAIQLVLDQSTGCGFASKRKYLFGRVSMKIKLIPGDSAGTVTAFYMNSDTA--TVRDELDFEFLGNRSGQPYSVQTNIFAHGKG--DREQRVNLWFDPSMDYHTYTILWSHKHIVFYVDDVPIREYKNNEAKNIAYPTSQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPV-PGPTFCPSNPHNWWEGYAYQSLNAV---EARRYRWVRVNHMVYDYCTDRSRFPVPPPEC 290          
BLAST of EY664666 vs. ExPASy Swiss-Prot
Match: XTH32_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 32 OS=Arabidopsis thaliana GN=XTH32 PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 5.681e-46
Identity = 91/186 (48.92%), Postives = 118/186 (63.44%), Query Frame = 3
Query:   27 DGKNVRLLLNRFSGSGFVSSKLYNHGFFSAMIKLPSDHTAGLCVAFYTSNGDVFPKTHDELDFEFLGNVAGKPWRFQTNFYGNGS---TARGREERYQLWFDPTKQFHRYSILWTSNNIIFYVDEVPIREVVRSKAMGGDFPSKPMSLYTTIWDASNWATSGGKAKVNYKYAPFTSEFKDFVLEGC 575
            D   + + L+R SGSGF S K +  G+F A IKL   +TAG+  + Y SN +  P  HDE+D EFLG   GKP+  QTN Y  GS      GRE +++LWFDPTK FH Y+ILW+   IIF VD++PIR   +  A    FP +PM LY +IWDAS+WAT  GK K +YKY PFT+++ +F   GC
Sbjct:   59 DQNALTIWLDRTSGSGFKSVKPFRSGYFGANIKLQPGYTAGVITSLYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVYIRGSGDGKIIGREMKFRLWFDPTKDFHHYAILWSPREIIFLVDDIPIRRYPKKSA--STFPLRPMWLYGSIWDASSWATEDGKYKADYKYQPFTAKYTNFKALGC 242          
The following BLAST results are available for this feature:
BLAST of EY664666 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
XTH30_ARATH2.343e-10863.83Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH29_ARATH5.232e-10057.81Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH27_ARATH4.908e-9058.51Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH28_ARATH2.693e-8856.64Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH33_ARATH3.550e-5641.43Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH2_ARATH2.016e-5143.43Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH31_ARATH7.927e-4841.63Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH1_SOLLC2.550e-4640.00Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH6_ARATH4.350e-4640.65Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH32_ARATH5.681e-4648.92Probable xyloglucan endotransglucosylase/hydrolase... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-069-A12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY664666 ID=EY664666; Name=EY664666; organism=Citrus sinensis; type=EST; length=928bp
CCACGCGTCCGCTCATTCGCTCCCCCGACGGCAAGAACGTTCGTCTCCTC
CTCAACCGCTTCTCCGGGTCCGGTTTTGTTTCGTCAAAGTTGTACAATCA
CGGGTTCTTTAGCGCCATGATCAAGTTGCCATCGGATCACACGGCTGGCT
TATGTGTTGCATTCTATACGTCAAACGGAGACGTGTTCCCAAAAACACAC
GACGAATTAGACTTTGAGTTTCTAGGAAACGTGGCTGGAAAACCGTGGAG
GTTCCAAACAAATTTCTATGGAAATGGGAGCACGGCACGTGGCAGAGAAG
AGAGATACCAGCTTTGGTTTGATCCCACGAAGCAATTTCATAGATATAGC
ATTCTTTGGACAAGCAACAACATTATATTCTATGTGGATGAAGTACCGAT
AAGGGAAGTCGTGCGCTCAAAGGCAATGGGTGGTGATTTCCCATCAAAGC
CAATGTCATTGTACACAACAATTTGGGATGCCTCAAATTGGGCCACATCA
GGTGGCAAAGCCAAAGTTAATTACAAGTACGCACCATTCACTTCTGAATT
TAAAGACTTTGTGTTAGAGGGCTGCCCTGTTGATCCCATTGAACAAGTCC
CCTCCTCCAACTGCCAAGACACCGATTCCCGGCTTGCCGAGAAAGGCCTC
TCCGTCATCACTCCGGCCGGGAGACGGGCCATGCGTANATTNCGGGGAGC
GTACATGTACTATTCATATTGTTATGATACAATGCGATACCCCGTGCCAT
TACCCGAATGTNGTCTTGNTCCATCAGAAACGACACGTTTTAAAGACACC
GGTAGGNTTGAATTCGGCGGCAGCCATAAGAATCATAGACATANGTCGAG
GCGGCAGCCCGGAGCTTCAATTCCGNAGATCCGGACATGTAAATNATTNA
TGGGGGGGGTGGGTTTATGCTCATGATT
back to top