CX671827

Overview
NameCX671827
Unique NameCX671827
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX671827_ssr65 microsatellite CX671827_ssr65:65..88. BLAST: Citrus ESTs to Prunus persica proteins V1
CX671827_ssr91 microsatellite CX671827_ssr91:91..100. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7468 contig Csv1_Contig7468:415..1276. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILL3_ORYSJ (IAA-amino acid hydrolase ILR1-like 3 OS=Oryza sativa subsp. japonica GN=ILL3 PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 3.434e-34
Identity = 75/126 (59.52%), Postives = 93/126 (73.81%), Query Frame = 2
Query:  302 QVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPNVHLTPVEMGAEDFSFYTQRMPAAHFYVGTRNE-------TLKPFIRLHSPYLVVDEDALPIGAALHAAVAISYLD 658
            +VIE QAAV++C+A +DFME+K+  YPATVNDE+MY H K V  SM+GE NV L+P  MGAEDF FY QR+PAA F +G  N+       T K   +LHSP+ VVDE+ALP+GAA HAAVAI YL+
Sbjct:  286 EVIEGQAAVNRCTAAVDFMEDKLPPYPATVNDEEMYAHAKAVAESMLGEANVKLSPQGMGAEDFGFYAQRIPAAFFGIGVGNDGGGMAETTTKN--QLHSPHFVVDEEALPVGAAFHAAVAIEYLN 409          
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILL4_ORYSJ (IAA-amino acid hydrolase ILR1-like 4 OS=Oryza sativa subsp. japonica GN=ILL4 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 7.650e-34
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 2
Query:  302 QVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPNVHLTPVEMGAEDFSFYTQRMPAAHFYVGTRN---------ETLKPFIRLHSPYLVVDEDALPIGAALHAAVAISYLD 658
            +VIE QAAV++C+A +DFME+K+R YPATVNDE MY H K V  SM+GE NV ++P+ MGAEDF FY QR+PAA F +G  +         ET K   +LHSP+ VVDE+ALP+GAA HAAVAI YL+
Sbjct:  281 EVIEGQAAVNRCTAAVDFMEDKLRPYPATVNDEGMYAHAKAVAESMLGEANVTVSPMCMGAEDFGFYAQRIPAAFFGIGVGSNGNDGGGMAETTKN--QLHSPHFVVDEEALPVGAAFHAAVAIEYLN 406          
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILL7_ORYSJ (IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sativa subsp. japonica GN=ILL7 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 3.214e-32
Identity = 66/120 (55.00%), Postives = 86/120 (71.67%), Query Frame = 2
Query:  302 QVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPNVHLTPVEMGAEDFSFYTQRMPAAHFYVGTRNE-TLKPFIRLHSPYLVVDEDALPIGAALHAAVAISYLD 658
            +++E  A VH+C+AT+DFMEE+   YPATVNDE MY H + V   ++GE  V +    MG+EDF+FY QR PAA F +G  NE T++    LHSP+ VVDED LP+GAALHAAVA+ YL+
Sbjct:  328 EIVEAHATVHRCTATVDFMEEERIPYPATVNDEGMYRHARAVAVDVLGEDGVKVGTPFMGSEDFAFYAQRFPAAFFMIGVGNETTMRKVYPLHSPHFVVDEDVLPVGAALHAAVAMEYLN 447          
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILR1_ARATH (IAA-amino acid hydrolase ILR1 OS=Arabidopsis thaliana GN=ILR1 PE=1 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 1.221e-31
Identity = 65/119 (54.62%), Postives = 87/119 (73.11%), Query Frame = 2
Query:  302 QVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPNVHLTPVEMGAEDFSFYTQRMPAAHFYVGTRNETLKPFIRLHSPYLVVDEDALPIGAALHAAVAISYLD 658
            ++ E QA+V++C A ++F E+K   +P   NDE +YEHGK+V  +M+G+ N H  PV MG EDFSF+TQ+  AA F +G +NETL     LHSPY  VDE+ALP+GAALHAA+A+SYLD
Sbjct:  310 EISEAQASVYRCKAEVNFEEKKPSLHPVMNNDEGLYEHGKKVAEAMIGKNNFHDFPVTMGGEDFSFFTQKTKAAIFVLGVKNETLGAGKPLHSPYFFVDEEALPVGAALHAAMAVSYLD 428          
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILL8_ORYSJ (IAA-amino acid hydrolase ILR1-like 8 OS=Oryza sativa subsp. japonica GN=ILL8 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.221e-31
Identity = 72/155 (46.45%), Postives = 101/155 (65.16%), Query Frame = 2
Query:  215 SNIRGTFTPLTEENCLNSN*GHRNSTYCYQVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPNVHLTPVEMGAEDFSFYTQRMPAAHFYVGTRNET-------LKPFIRLHSPYLVVDEDALPIGAALHAAVAISYLD 658
            +++ GTF  +T+E         R      ++IE QA V++C+A +DF+EE++R YPATVND+ MY H K V  +M+GE NV +    MG EDF+FY +R P A F++G  NET       ++P   +HSP+ V+DE ALP+GAALHAAVAI YL+
Sbjct:  294 ASLGGTFRSMTDEGLAYLMKRIR------EIIEAQAGVNRCAAAVDFLEEELRPYPATVNDDGMYGHAKAVAEAMLGEANVRVAARSMGGEDFAFYARRSPGAFFFIGVGNETTMGPAAAVRP---VHSPHFVLDERALPVGAALHAAVAIEYLN 439          
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILL9_ORYSJ (IAA-amino acid hydrolase ILR1-like 9 OS=Oryza sativa subsp. japonica GN=ILL9 PE=2 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 3.677e-28
Identity = 62/121 (51.24%), Postives = 79/121 (65.29%), Query Frame = 2
Query:  302 QVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPNVHLTPVEMGAEDFSFYTQRMPAAHFYVGTRNET---LKPFIRLHSPYLVVDEDALPIGAALHAAVAISYL 655
            +++E QAAV++C   +DFMEE MR YPA VNDE MY H +     ++G   V + P  MGAEDF FY  RMP+A F +G  N T    +     HSP+ V+DE ALP+GAA+HAAVAI YL
Sbjct:  313 EIVEGQAAVNRCGGGVDFMEESMRPYPAVVNDEGMYAHARASAERLLGAGGVRVAPQLMGAEDFGFYAARMPSAFFTIGVGNATTSSARAAHTTHSPHFVIDEAALPVGAAVHAAVAIDYL 433          
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILL6_ORYSJ (IAA-amino acid hydrolase ILR1-like 6 OS=Oryza sativa subsp. japonica GN=ILL6 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.070e-27
Identity = 62/120 (51.67%), Postives = 76/120 (63.33%), Query Frame = 2
Query:  302 QVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPNVHLTPVEMGAEDFSFYTQRMPAAHFYVGTRNETLKPFIRLHSPYLVVDEDALPIGAALHAAVAISYLDN 661
            +VI  QA VH C A +DF E +   YP TVND +MY H K V   ++G  +    P  MGAEDFSFY+Q +PA  +Y+G RNETL      HSPY ++DED LP GAA HAA+A  YL N
Sbjct:  371 EVITAQARVHGCEAAVDFFENQS-FYPPTVNDARMYAHVKAVAGELLGAGSYRDVPPMMGAEDFSFYSQVVPAGFYYIGVRNETLGSVHTGHSPYFMIDEDVLPTGAAFHAAIAERYLAN 489          
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILL6_ARATH (IAA-amino acid hydrolase ILR1-like 6 OS=Arabidopsis thaliana GN=ILL6 PE=2 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 4.970e-25
Identity = 56/132 (42.42%), Postives = 86/132 (65.15%), Query Frame = 2
Query:  284 NSTYCY------QVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPNVHLTPVEMGAEDFSFYTQRMPAAHFYVGTRNETLKPFIRLHSPYLVVDEDALPIGAALHAAVAISYLDN 661
            NS++ Y      +V+  Q  V  C AT++F E++   YP T N++  Y H K+V   ++G+ +  L P  MGAEDF+FY++ +PAA +++G RNE L      HSP+ ++DED+LP+GAA+HAAVA  YL++
Sbjct:  330 NSSFYYLKKRIQEVLMDQVGVFGCQATVNFFEKQNAIYPPTTNNDATYNHLKKVTIDLLGDSHFTLAPQMMGAEDFAFYSEIIPAAFYFIGIRNEELGSVHIAHSPHFMIDEDSLPVGAAVHAAVAERYLND 461          
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILL4_ARATH (IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsis thaliana GN=ILL4 PE=1 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 2.727e-23
Identity = 56/123 (45.53%), Postives = 81/123 (65.85%), Query Frame = 2
Query:  302 QVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPN-VHLTPVEMGAEDFSFYTQRMPAAHFYVGTRNETLKPFIRLHSPYLVVDEDALPIGAALHAAVAISYLDNLE 667
            QVI  QA+V+ C+AT+DF+EE+   +P TVND+ +++  K V   M+G  N V + P+ MG+EDFSFY Q +P    +VG +N+   P    HSPY  V+E+ LP GA+LHA++A  YL  L+
Sbjct:  306 QVITRQASVNMCNATVDFIEEEKPFFPPTVNDKALHQFFKNVSGDMLGIENYVEMQPL-MGSEDFSFYQQAIPGHFSFVGMQNKARSPMASPHSPYFEVNEELLPYGASLHASMATRYLLELK 427          
BLAST of CX671827 vs. ExPASy Swiss-Prot
Match: ILL1_ORYSJ (IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. japonica GN=ILL1 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.354e-21
Identity = 51/119 (42.86%), Postives = 75/119 (63.03%), Query Frame = 2
Query:  302 QVIEMQAAVHQCSATIDFMEEKMRHYPATVNDEKMYEHGKRVGASMVGEPNVHLTPVEMGAEDFSFYTQRMPAAHFY-VGTRNETLKPFIRLHSPYLVVDEDALPIGAALHAAVAISYL 655
            +VI  QA+V +C+A +DF+++    +P T+N   +++   +V + MVG  NV      MGAEDF+FY   +PA ++Y +G  NET  P    HSPY  ++EDALP GAAL A++A  YL
Sbjct:  307 EVIVSQASVQRCNAVVDFLDKDRPFFPPTINSAGLHDFFVKVASEMVGPKNVRDKQPLMGAEDFAFYADAIPATYYYFLGMYNETRGPQAPHHSPYFTINEDALPYGAALQASLAARYL 425          
The following BLAST results are available for this feature:
BLAST of CX671827 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
ILL3_ORYSJ3.434e-3459.52IAA-amino acid hydrolase ILR1-like 3 OS=Oryza sati... [more]
ILL4_ORYSJ7.650e-3458.59IAA-amino acid hydrolase ILR1-like 4 OS=Oryza sati... [more]
ILL7_ORYSJ3.214e-3255.00IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sati... [more]
ILR1_ARATH1.221e-3154.62IAA-amino acid hydrolase ILR1 OS=Arabidopsis thali... [more]
ILL8_ORYSJ1.221e-3146.45IAA-amino acid hydrolase ILR1-like 8 OS=Oryza sati... [more]
ILL9_ORYSJ3.677e-2851.24IAA-amino acid hydrolase ILR1-like 9 OS=Oryza sati... [more]
ILL6_ORYSJ1.070e-2751.67IAA-amino acid hydrolase ILR1-like 6 OS=Oryza sati... [more]
ILL6_ARATH4.970e-2542.42IAA-amino acid hydrolase ILR1-like 6 OS=Arabidopsi... [more]
ILL4_ARATH2.727e-2345.53IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsi... [more]
ILL1_ORYSJ4.354e-2142.86IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sati... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_13D05_b Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-13D05-G9-6.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671827 ID=CX671827|Name=CX671827|organism=Citrus sinensis|type=EST|length=862bp
TTTTTTTTTTTTTTTTTGCTTCAAATGTAGCTGAAAGAGTAGACTCCCTT
TCAAGGCTGTGATCATATATATATATATATATATATATACATATATATAT
TTATTACATAAGATTATTGCTCAAGAGTACAACTCATATTACATGAGATT
ACAACTGATATTTACAAATCAAACTATTACTAGAATTAGTAAGCCTGCCC
AGATTTTTACTCTCTCTAATATTCGAGGGACGTTTACTCCACTCACAGAA
GAAAACTGCCTTAACTCAAATTGAGGTCATAGAAATAGCACTTATTGTTA
TCAGGTCATAGAAATGCAAGCAGCAGTTCATCAGTGTAGTGCAACAATAG
ACTTCATGGAGGAAAAAATGAGGCATTATCCGGCAACTGTAAATGATGAA
AAAATGTATGAACACGGCAAGAGGGTCGGCGCATCCATGGTTGGAGAGCC
AAACGTGCATCTTACTCCAGTTGAGATGGGAGCAGAGGACTTCAGCTTCT
ACACTCAGAGGATGCCAGCTGCACATTTTTATGTCGGTACAAGGAATGAA
ACGCTTAAGCCATTCATCCGACTGCACTCCCCGTACTTAGTTGTTGATGA
GGATGCCCTTCCTATTGGAGCAGCTCTTCATGCTGCAGTAGCCATCTCTT
ACTTGGACAACCTTGAAGTTGAAGTACAATAGGAATGGTGTGTCTTCGTA
AGAGAGTTTTATTTTTGAACTAGTAAAAAAGAATTGTATATTTAAATCCA
GTGGTATTTCAATGCCGTCCTTGTAATAATAAACCATCTTAATTTATCGT
GAATTTATGATGAAGAGGCTCTAGCATAACATTAACCAATCCGTTGAAAC
TGAATAGAAACA
back to top