CX671822

Overview
NameCX671822
Unique NameCX671822
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length704
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10342 contig Csv1_Contig10342:22..725. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671822 vs. ExPASy Swiss-Prot
Match: RK21_ARATH (50S ribosomal protein L21, chloroplastic OS=Arabidopsis thaliana GN=RPL21 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.469e-42
Identity = 84/123 (68.29%), Postives = 95/123 (77.24%), Query Frame = 1
Query:  310 VESAAKEEPKREEIFAVVMIGSRQYIVFPGRFIYTQRLKGANVNDKIILNKVLLVGTKTTTYIGKPVVTNAAVHAVVEEQGLNPXXXXXXXXXXXXXXXXXGHRQPNTRIRITGITGYQDYPA 678
            V    +E+ KREEIFAV+M+G RQYIVFPGR++YTQRLK ANV+D+I+LNKVLLVGTKT TYIGKPVVTNA VHAVVE QGLN                  GHRQPNTRIRITGITGY++YPA
Sbjct:   87 VSEVTEEKAKREEIFAVIMVGGRQYIVFPGRYLYTQRLKDANVDDQIVLNKVLLVGTKTHTYIGKPVVTNATVHAVVESQGLNDKVVVFKYKPKKKYRRNIGHRQPNTRIRITGITGYEEYPA 209          
BLAST of CX671822 vs. ExPASy Swiss-Prot
Match: RK21_SPIOL (50S ribosomal protein L21, chloroplastic OS=Spinacia oleracea GN=RPL21 PE=1 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.920e-40
Identity = 84/120 (70.00%), Postives = 94/120 (78.33%), Query Frame = 1
Query:  334 PKREEIFAVVMIGSRQYIVFPGRFIYTQRLKGANVNDKIILNKVLLVGTKTTTYIGKPVVTNAAVHAVVEEQGLNPXXXXXXXXXXXXXXXXXGHRQPNTRIRITGITGYQDYPAVTLDS 693
            P REEIFAVV+IGSRQYIV PGR+IYTQRLKGA VNDKI+LNKVLLVGTK +TYIG P+VTNAAVHAVVEEQ L+                  GHRQP TRI+ITGITGY+DYPA TL++
Sbjct:  118 PPREEIFAVVVIGSRQYIVIPGRWIYTQRLKGATVNDKIVLNKVLLVGTKASTYIGTPIVTNAAVHAVVEEQLLDDKVIVFKYKKKKNYRRNIGHRQPITRIKITGITGYEDYPASTLEA 237          
BLAST of CX671822 vs. ExPASy Swiss-Prot
Match: RM21_ARATH (50S ribosomal protein L21, mitochondrial OS=Arabidopsis thaliana GN=RPL21M PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.733e-17
Identity = 46/108 (42.59%), Postives = 66/108 (61.11%), Query Frame = 1
Query:  343 EEIFAVVMIGSRQYIVFPGRFIYTQRLKGANVNDKIILNKVLLVGTKTTTYIGKPVVTNAAVHAVVEEQGLNPXXXXXXXXXXXXXXXXXGHRQPNTRIRITGITGYQ 666
            E +FA+V IGS Q+ V  G  I+T++LK  ++NDK+ L KVLL+G+ + T IG+P++ +A VHAVVEE  L+                  GHRQ  T++RIT I G +
Sbjct:  138 EPVFAIVQIGSHQFKVSNGDSIFTEKLKFCDINDKLELTKVLLLGSASQTIIGRPILPDATVHAVVEEHALDEKVLIFKKKRRKNYRRTRGHRQELTKLRITDIQGIE 245          
BLAST of CX671822 vs. ExPASy Swiss-Prot
Match: RM21_DICDI (Probable 39S ribosomal protein L21, mitochondrial OS=Dictyostelium discoideum GN=mrpl21 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.006e-11
Identity = 44/117 (37.61%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  334 PKREEIFAVVMIGSRQYIVFPGRFIYTQRLKGANVNDKIILNKVLLVGTKTTTYIGKPVVTNAAVHAVVEEQGLNPXXXXXXXXXXXXXXXXXGHRQPNTRIRITGITGYQDYPAVT 684
            P  ++ FAVV I  +QY V  G  I T +++  +V + I+L+KVLLVGTK  T IGKP+++N  VHA +EEQ                     G +   T IRI GI   Q+    T
Sbjct:   56 PIGKDSFAVVHISGKQYKVIEGDIIMTDKIQ-VDVGEHIVLDKVLLVGTKNETIIGKPIISNFKVHAYIEEQAKTEHVTIFKHKPRKNYKRTTGFQGLATYIRIGGIIKGQETTTTT 171          
The following BLAST results are available for this feature:
BLAST of CX671822 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
RK21_ARATH5.469e-4268.2950S ribosomal protein L21, chloroplastic OS=Arabid... [more]
RK21_SPIOL3.920e-4070.0050S ribosomal protein L21, chloroplastic OS=Spinac... [more]
RM21_ARATH2.733e-1742.5950S ribosomal protein L21, mitochondrial OS=Arabid... [more]
RM21_DICDI1.006e-1137.61Probable 39S ribosomal protein L21, mitochondrial ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_13D02_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-13D02-G3-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671822 ID=CX671822|Name=CX671822|organism=Citrus sinensis|type=EST|length=704bp
AAGCTCACTTAACTAGCGAGTGGCAAGCAAACGCAAAGGGCCATGGCAGC
GGCATCATCTTGTGCAACACTTGCGCTTTGTTCATCTCTTACCAGTCACT
GCAAAATCTCATGCCAAAACCCTAATCCCCATCCTCAGCTTTCTCTTTCG
AAATCGAAACTCTGCTCTTTTCCTTCACCAAAACTCTATACAAGACCCAC
ATTTTCATTCACACGCAAATTCTCCCAAACGGAACCGCCGCCAGTTTCAG
AACCGGAAGTAGAACCCGAAGCTGCTCTCGAAGCCGAAGCCAAACCCACT
ACCGAGGTTGTTGAGTCCGCTGCCAAAGAAGAGCCCAAGCGTGAGGAGAT
TTTTGCTGTCGTTATGATTGGGTCACGCCAATATATTGTCTTCCCTGGGC
GATTTATCTACACTCAGAGGCTTAAAGGTGCCAATGTCAATGATAAGATT
ATTTTGAACAAGGTGTTGCTTGTAGGCACAAAAACAACTACCTATATCGG
AAAACCTGTGGTCACTAATGCTGCCGTACATGCAGTTGTCGAGGAGCAAG
GTTTAAACCCCAAAGTAATTGTCTTCAAGTATAAGAAGAAAAAGAACTAT
CGGAGGAATATCGGCCACCGACAGCCAAATACGCGGATAAGGATAACTGG
CATCACTGGCTATCAAGACTATCCGGCAGTCACACTTGATTCACTAAAAT
CTGT
back to top