CX671816

Overview
NameCX671816
Unique NameCX671816
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length768
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX671816_ssr295 microsatellite CX671816_ssr295:295..304. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9888 contig Csv1_Contig9888:56..823. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: PHR2_ARATH (Blue-light photoreceptor PHR2 OS=Arabidopsis thaliana GN=PHR2 PE=2 SV=2)

HSP 1 Score: 293.893 bits (751), Expect = 6.492e-79
Identity = 154/231 (66.67%), Postives = 179/231 (77.49%), Query Frame = 3
Query:   75 KQNLENPENHSNEEQNPLATIPSQSPFATLSLSFSLPQVLPANTFFIQPKISTLFSHQPNKVKAPTQAXXXXXXXXXXXXXXXXXXXXFKSTLSANPLQSPLSLGPHRPLDPNNGAAIRRASIVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDYGKSSSGFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIGADAVYAHREVSHDEVKS 767
            ++NL NPE  S EEQNPLA   S  P A+LSL+     + P++T F++     LF+H PNKVK PTQA                    FKST++ANPLQSPLS+ P RP+DP++ AA+RRA++VWFRNDLRVHDNE LN+AN+E VSVLPVYCFDPRDYGKSSSGFDKTGP+RA FLIESVS+LRKNLQARGS+LVVRVGKPE VLVELAK IGADAVYAHREVSHDEVK+
Sbjct:    7 EENL-NPETKSAEEQNPLAIFHSSLPIASLSLT-----LFPSSTQFLK-----LFAHHPNKVKIPTQASSLTHLSLSSVSPFPSSRISFKSTIAANPLQSPLSIVPRRPVDPSSAAALRRAAVVWFRNDLRVHDNECLNSANDECVSVLPVYCFDPRDYGKSSSGFDKTGPFRAQFLIESVSELRKNLQARGSNLVVRVGKPEAVLVELAKEIGADAVYAHREVSHDEVKA 226          
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: CRYD_GLOVI (Cryptochrome DASH OS=Gloeobacter violaceus GN=cry PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.381e-27
Identity = 56/107 (52.34%), Postives = 81/107 (75.70%), Query Frame = 3
Query:  441 IVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDYGKSSSGFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIGADAVYAHREVSHDEV 761
            +VW+RNDLRVHD+E L +A +++  V+ +YCFDPR +GK+  GF+KTGP+RA FL+ESV+DLR++L+  GSDL+VR G PE V+  L   +   AV+ H EV+ +E+
Sbjct:    7 LVWYRNDLRVHDHEPLTSALHKNARVVALYCFDPRQFGKAPFGFEKTGPFRARFLLESVADLRRSLRQLGSDLLVRRGHPEEVIPALVSELEIAAVHYHGEVTSEEL 113          
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: CRYD_SOLLC (Cryptochrome DASH, chloroplastic/mitochondrial OS=Solanum lycopersicum GN=CRYD PE=3 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 7.050e-25
Identity = 59/110 (53.64%), Postives = 77/110 (70.00%), Query Frame = 3
Query:  438 SIVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDYGKSSS-GFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIGADAVYAHREVSHDEVK 764
            +IVWFRNDLRV DNE+L  A   S ++LPVYC DPR +G +   G  KTG  RA F+IE ++DL++NL  RG DL+++ GKPE ++  LAKA  A  VYAH+E   +EVK
Sbjct:   80 AIVWFRNDLRVLDNEALLRAWVSSEAILPVYCVDPRLFGTTHYFGMPKTGALRAQFIIECLNDLKRNLVKRGLDLLIQHGKPEDIVPSLAKAYKAHTVYAHKETCSEEVK 189          
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: CRYD_SYNY3 (Cryptochrome DASH OS=Synechocystis sp. (strain PCC 6803) GN=cry PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.203e-24
Identity = 50/107 (46.73%), Postives = 77/107 (71.96%), Query Frame = 3
Query:  441 IVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDYGKSSSGFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIGADAVYAHREVSHDEV 761
            +VWFRNDLR+HD+E L+ A    +++  VYC+DPR + ++  GF KTGP+R++FL +SV +L ++LQ  G+ L+V  G PE V+ ++AK I A  +Y HREV+ +E+
Sbjct:    9 LVWFRNDLRLHDHEPLHRALKSGLAITAVYCYDPRQFAQTHQGFAKTGPWRSNFLQQSVQNLAESLQKVGNKLLVTTGLPEQVIPQIAKQINAKTIYYHREVTQEEL 115          
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: CRYD_ORYSJ (Cryptochrome DASH, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=CRYD PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.051e-24
Identity = 59/110 (53.64%), Postives = 76/110 (69.09%), Query Frame = 3
Query:  438 SIVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDYGKSSS--GFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIGADAVYAHREVSHDEV 761
            +IVWFRNDLRV DNE++  A   S +VLPVYC DPR    S+   GF KTG  RA FLIE + DL++NL  +G DL++R GKPE +L  +AKA+ A  VYAH+E   +E+
Sbjct:   86 AIVWFRNDLRVLDNEAVVRAWAASDAVLPVYCVDPRISAGSTHYFGFPKTGALRAQFLIECLEDLKRNLTKQGLDLLIRHGKPEDILPSIAKAVTAHTVYAHKETCSEEL 195          
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: CRYD_ARATH (Cryptochrome DASH, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=CRYD PE=1 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 2.268e-23
Identity = 56/109 (51.38%), Postives = 74/109 (67.89%), Query Frame = 3
Query:  438 SIVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDYGKSSS-GFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIGADAVYAHREVSHDEV 761
            +I+WFRNDLRV DN++L  A + S ++LPVYC DPR +  +    F KTG  R  FL+E + DLRKNL  RG +L++R GKPE +L  LAK  GA  V+AH+E   +EV
Sbjct:   86 TILWFRNDLRVLDNDALYKAWSSSDTILPVYCLDPRLFHTTHFFNFPKTGALRGGFLMECLVDLRKNLMKRGLNLLIRSGKPEEILPSLAKDFGARTVFAHKETCSEEV 194          
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: CRYD_XENLA (Cryptochrome DASH OS=Xenopus laevis GN=cry-dash PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 9.528e-22
Identity = 54/111 (48.65%), Postives = 73/111 (65.77%), Query Frame = 3
Query:  432 RASIVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDY-GKSSSGFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIG-ADAVYAHREVSHDE 758
            R  I   RNDLR+HDNE L+ A+  +  ++P+YCFDPR Y G     F KTGP+R  FL+ESV DLR  L+ +GS+L++R GKPE V+ +L K +G   AV  H E + +E
Sbjct:    6 RVIICLLRNDLRLHDNEVLHWAHRNADQIVPLYCFDPRHYVGTHYFNFPKTGPHRLKFLLESVRDLRITLKKKGSNLLLRRGKPEEVIEDLVKQLGNVSAVTLHEEATKEE 116          
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: CRYD_NATPD (Cryptochrome DASH OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=cry PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 9.528e-22
Identity = 54/107 (50.47%), Postives = 75/107 (70.09%), Query Frame = 3
Query:  438 SIVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDYGKSSSGFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIGADAVYAHREVSHDE 758
            ++VWFR+DLRV DN +L  A   + +V+PVY FDP  Y +S  G  KTG +RA F  ++V+DLR +L+ RG DL+VR G+P TV+ ELA+  GADAVYA  + + +E
Sbjct:    4 AVVWFRDDLRVTDNPTLADAVAAAETVIPVYTFDPDRYTESEYGPPKTGGHRAVFRRQAVADLRASLRDRGGDLLVRSGRPATVVPELAQRAGADAVYAQTKPATEE 110          
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: CRYD_DANRE (Cryptochrome DASH OS=Danio rerio GN=cry-dash PE=2 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 2.772e-21
Identity = 54/111 (48.65%), Postives = 71/111 (63.96%), Query Frame = 3
Query:  432 RASIVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDY-GKSSSGFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIGADAVYA-HREVSHDE 758
            R  I   RNDLR+HDNE  + A   +  ++P+YCFDPR Y G     F KTGP+R  FL++SV DLR  L+  GS L+VR GKPE V+ EL K +G+ +  A H EV+ +E
Sbjct:    5 RTVICLLRNDLRLHDNEVFHWAQRNAEHIIPLYCFDPRHYQGTYHYNFPKTGPFRLRFLLDSVKDLRALLKKHGSTLLVRQGKPEDVVCELIKQLGSVSTVAFHEEVASEE 115          
BLAST of CX671816 vs. ExPASy Swiss-Prot
Match: CRYD_RHOBA (Cryptochrome DASH OS=Rhodopirellula baltica GN=cry PE=3 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 6.176e-21
Identity = 49/107 (45.79%), Postives = 70/107 (65.42%), Query Frame = 3
Query:  438 SIVWFRNDLRVHDNESLNTANNESVSVLPVYCFDPRDYGKSSSGFDKTGPYRASFLIESVSDLRKNLQARGSDLVVRVGKPETVLVELAKAIGADAVYAHREVSHDE 758
            ++VWFRNDLR  D+E    A+        V+C DPR +  +  GF +TGP+RA FLIE+++DLR  L++ G +L+VRVG+PETVL  L  ++  DAV+ H E   +E
Sbjct:    4 ALVWFRNDLRTIDHEPFLRASTAD-RCFAVHCIDPRQFETTELGFQRTGPFRARFLIENLTDLRSRLRSLGGELIVRVGRPETVLQHLLPSLAIDAVHFHHEPRTEE 109          
The following BLAST results are available for this feature:
BLAST of CX671816 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
PHR2_ARATH6.492e-7966.67Blue-light photoreceptor PHR2 OS=Arabidopsis thali... [more]
CRYD_GLOVI3.381e-2752.34Cryptochrome DASH OS=Gloeobacter violaceus GN=cry ... [more]
CRYD_SOLLC7.050e-2553.64Cryptochrome DASH, chloroplastic/mitochondrial OS=... [more]
CRYD_SYNY31.203e-2446.73Cryptochrome DASH OS=Synechocystis sp. (strain PCC... [more]
CRYD_ORYSJ2.051e-2453.64Cryptochrome DASH, chloroplastic/mitochondrial OS=... [more]
CRYD_ARATH2.268e-2351.38Cryptochrome DASH, chloroplastic/mitochondrial OS=... [more]
CRYD_XENLA9.528e-2248.65Cryptochrome DASH OS=Xenopus laevis GN=cry-dash PE... [more]
CRYD_NATPD9.528e-2250.47Cryptochrome DASH OS=Natronomonas pharaonis (strai... [more]
CRYD_DANRE2.772e-2148.65Cryptochrome DASH OS=Danio rerio GN=cry-dash PE=2 ... [more]
CRYD_RHOBA6.176e-2145.79Cryptochrome DASH OS=Rhodopirellula baltica GN=cry... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_13C10_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-13C10-E19-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671816 ID=CX671816|Name=CX671816|organism=Citrus sinensis|type=EST|length=768bp
GCAGCTTATCTCCATCCAGTTCAGCTGCAACACAATTTTCATCTTCCATC
TTCAGGGTTGAAATGGATCCCAATAAGCAAAATCTTGAAAACCCAGAAAA
CCATTCCAATGAGGAACAAAACCCACTTGCGACTATCCCTTCTCAATCAC
CATTTGCCACTCTTTCCCTCTCATTTTCTCTCCCCCAAGTCCTCCCAGCC
AACACTTTCTTCATTCAACCCAAAATTTCCACCTTATTTTCCCACCAACC
AAACAAGGTCAAAGCCCCCACACAAGCCTCTACGCTTACCCACATCTCTC
TCTCCGCCTCCTCCACTCTCTCTCCTTCCAAAATTTCATTCAAGTCCACA
CTCTCCGCAAACCCTCTTCAGAGCCCTCTCTCTTTAGGGCCCCACCGCCC
CTTGGACCCGAACAATGGGGCCGCAATTCGTCGAGCTTCCATTGTTTGGT
TCCGCAACGACTTGCGGGTCCATGATAACGAATCTCTCAACACCGCCAAT
AACGAGAGCGTCTCTGTTTTGCCTGTTTATTGTTTCGACCCGAGGGATTA
CGGCAAATCCTCTTCTGGCTTTGACAAAACGGGGCCGTATCGGGCATCGT
TTTTGATTGAGTCAGTTTCTGACCTTCGCAAGAACTTGCAGGCACGTGGG
TCTGATCTCGTGGTGAGAGTGGGAAAGCCGGAGACTGTTCTGGTCGAGTT
GGCTAAAGCCATTGGAGCTGATGCAGTGTACGCGCACAGAGAGGTGTCAC
ATGATGAGGTTAAATCGG
back to top