CX671680

Overview
NameCX671680
Unique NameCX671680
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length778
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPOD_ANASP (RNA polymerase sigma factor rpoD OS=Anabaena sp. (strain PCC 7120) GN=rpoD PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.639e-19
Identity = 50/128 (39.06%), Postives = 78/128 (60.94%), Query Frame = 2
Query:  395 LTPSEEAEICYSLKEGAKLEEARKTVAQAEEHESISKQLAKATGMKQSKVDKILCKERESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            L   EE E+   + +  +LE  R+ +++  E +    + A+A  +        L   R +++++++S   LVVSIA  Y  +GLS +DLIQEGS+GL+R A++F+ E+GYK STY  WWI+QAI R I
Sbjct:   95 LRADEEIELARKIADLLELERVRERLSEKLERDPRDSEWAEAVQLPLPAFRYRLHIGRRAKDKMVQSNLRLVVSIAKKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAI 222          
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPOD1_SYNE7 (RNA polymerase sigma factor rpoD1 OS=Synechococcus elongatus (strain PCC 7942) GN=rpoD1 PE=3 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 1.310e-18
Identity = 49/128 (38.28%), Postives = 75/128 (58.59%), Query Frame = 2
Query:  395 LTPSEEAEICYSLKEGAKLEEARKTVAQAEEHESISKQLAKATGMKQSKVDKILCKERESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            L   EE E+   + +   LE  R  + +  +      + A A      +  + L + R +++++++S   LVVSIA  Y  +GLS +DLIQEGS+GL+R A++F+ E+GYK STY  WWI+QAI R I
Sbjct:  104 LRADEEIELARQIADLLALERIRDELLEQLDRLPSDAEWAAAVDSPLDEFRRRLFRGRRAKDKMVQSNLRLVVSIAKKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAI 231          
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPOD3_SYNE7 (RNA polymerase sigma factor rpoD3 OS=Synechococcus elongatus (strain PCC 7942) GN=rpoD3 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.109e-17
Identity = 47/129 (36.43%), Postives = 78/129 (60.47%), Query Frame = 2
Query:  395 LTPSEEAEICYSLKEGAKLEEARKTVAQAE-EHESISKQLAKATGMKQSKVDKILCKERESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            LT  EE  +   +++  KL+E R+T+   E + +    + A A G+   ++ +      +++ ++I +   LVVS+A  Y  + + L DLIQEG+IG+ RG ++F+P +GY+ STY YWWI+QAI R I
Sbjct:   25 LTHEEEVVLGKRVQQWMKLQELRQTLQSEEGDRDPSDLEWAAAAGLSIEELRQQQHLGEQAKRKMIEANLRLVVSVAKKYLKRNMDLLDLIQEGTIGMQRGVEKFDPTKGYRFSTYAYWWIRQAITRAI 153          
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPOD2_SYNE7 (RNA polymerase sigma factor rpoD2 OS=Synechococcus elongatus (strain PCC 7942) GN=rpoD2 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.448e-17
Identity = 46/125 (36.80%), Postives = 75/125 (60.00%), Query Frame = 2
Query:  410 EAEICYS--LKEGAKLEEARKTVAQAEEHESISKQLAKATGMKQSKVDKILCKERESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            E E+C+   ++    L +A+  +     HE   ++ A A  +    +D+ + + + ++ ++I +   LVVSIA  YQ + +   DLIQEG++GL RG ++F+P +GYK STY YWWI+QAI R I
Sbjct:   29 EEELCFGRQVQRLMMLLDAQTELRDRLGHEPSKEEWAAAVDLNLEDLDRQIEQGQRAKRKMIEANLRLVVSIAKKYQKRHMEFLDLIQEGTLGLERGVEKFDPSKGYKFSTYAYWWIRQAITRAI 153          
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPOD_SYNY3 (RNA polymerase sigma factor rpoD OS=Synechocystis sp. (strain PCC 6803) GN=rpoD PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.470e-17
Identity = 44/115 (38.26%), Postives = 72/115 (62.61%), Query Frame = 2
Query:  434 KEGAKLEEARKTVAQAEEHESISKQLAKATGMKQSKVDKILCKERESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            K+  K ++    +A  +   S+  + ++      +   + L  +R +++++++S   LVVSIA  Y  +GLS +DLIQEGS+GL+R A++F+ E+GYK STY  WWI+QAI R I
Sbjct:  143 KKEPKKKDIDSYLANPDNELSLENEWSQQPNKNFAAFRRRLFLDRRAKDKMVQSNLRLVVSIAKKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAI 257          
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPOD_MICAE (RNA polymerase sigma factor rpoD1 OS=Microcystis aeruginosa GN=rpoD1 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 7.186e-17
Identity = 40/71 (56.34%), Postives = 55/71 (77.46%), Query Frame = 2
Query:  566 RESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            R ++E++++S   LVVSIA  Y  +GLS +DLIQEGS+GL+R A++F+ E+GYK STY  WWI+QAI R I
Sbjct:  178 RRAKEKMVQSNLRLVVSIAKKYMNRGLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAI 248          
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPSC_ANASP (RNA polymerase sigma-C factor OS=Anabaena sp. (strain PCC 7120) GN=sigC PE=3 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 9.385e-17
Identity = 39/92 (42.39%), Postives = 63/92 (68.48%), Query Frame = 2
Query:  503 KQLAKATGMKQSKVDKILCKERESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            ++ A+   M   +++K+  +  +S+E +I++   LVVS+A  YQ +GL L DL+QEG++GL R  ++F+P +GY+ STY YWWI+Q I R I
Sbjct:  154 RRWAEIAKMTVEELEKMQSQGLQSKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGYRFSTYAYWWIRQGITRAI 245          
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPSB_ANASP (RNA polymerase sigma-B factor OS=Anabaena sp. (strain PCC 7120) GN=sigB PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.566e-16
Identity = 46/127 (36.22%), Postives = 79/127 (62.20%), Query Frame = 2
Query:  404 SEEAEICYS--LKEGAKLEEARKTVAQAEEHESISKQLAKATGMKQSKVDKILCKERESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            S E EI ++  +++   +  A++ +A+  + E   ++ A    +K+  + + L + + +++++I++   LVVSIA  YQ + L   DLIQEG++GL RG ++F+P  GYK STY YWWI+Q I R I
Sbjct:   39 SHEQEIFFAQQVQQMMVMFTAKEELAEKLQREPTLQEWADKMQLKEDVLLQQLSQGQIAKQKMIQANLRLVVSIAKKYQKRNLEFLDLIQEGALGLERGVEKFDPTLGYKFSTYAYWWIRQGITRAI 165          
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPOD_THEMA (RNA polymerase sigma factor rpoD OS=Thermotoga maritima GN=rpoD PE=1 SV=3)

HSP 1 Score: 85.1149 bits (209), Expect = 4.658e-16
Identity = 39/72 (54.17%), Postives = 55/72 (76.39%), Query Frame = 2
Query:  563 ERESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            +++++E++I S   LVVSIA  Y G+GLS +DLIQEG+IGLL+  ++F+  +GYK STY  WWI+QAI R I
Sbjct:  152 DKKAKEKLITSNLRLVVSIAKRYMGRGLSFQDLIQEGNIGLLKAVEKFDWRKGYKFSTYATWWIRQAITRAI 223          
BLAST of CX671680 vs. ExPASy Swiss-Prot
Match: RPOD_STRAU (RNA polymerase sigma factor rpoD OS=Streptomyces aureofaciens GN=rpoD PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.658e-16
Identity = 44/128 (34.38%), Postives = 73/128 (57.03%), Query Frame = 2
Query:  395 LTPSEEAEICYSLKEGAKLEEARKTVAQAEEHESISKQLAKATGMKQSKVDKILCKERESQERIIRSYRSLVVSIATGYQGKGLSLKDLIQEGSIGLLRGAKRFNPERGYKLSTYVYWWIKQAIIRTI 778
            LT +EE ++   ++ G   EE     A  +   ++              +D+++   R ++ R+I S   LVVS+A  Y G+GL++ DL+QEG++GL+R  ++F+  RGYK STY  WWI+QA+ R +
Sbjct:   34 LTAAEEVDLARRVEAGLFAEEKLGGAADLDSQLAVD-------------LDRLVVMGRMAKRRLIESNLRLVVSVAKRYVGRGLTMLDLVQEGNLGLIRAVEKFDYARGYKFSTYATWWIRQAMSRAL 148          
The following BLAST results are available for this feature:
BLAST of CX671680 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 95
Match NameE-valueIdentityDescription
RPOD_ANASP2.639e-1939.06RNA polymerase sigma factor rpoD OS=Anabaena sp. (... [more]
RPOD1_SYNE71.310e-1838.28RNA polymerase sigma factor rpoD1 OS=Synechococcus... [more]
RPOD3_SYNE71.109e-1736.43RNA polymerase sigma factor rpoD3 OS=Synechococcus... [more]
RPOD2_SYNE71.448e-1736.80RNA polymerase sigma factor rpoD2 OS=Synechococcus... [more]
RPOD_SYNY32.470e-1738.26RNA polymerase sigma factor rpoD OS=Synechocystis ... [more]
RPOD_MICAE7.186e-1756.34RNA polymerase sigma factor rpoD1 OS=Microcystis a... [more]
RPSC_ANASP9.385e-1742.39RNA polymerase sigma-C factor OS=Anabaena sp. (str... [more]
RPSB_ANASP3.566e-1636.22RNA polymerase sigma-B factor OS=Anabaena sp. (str... [more]
RPOD_THEMA4.658e-1654.17RNA polymerase sigma factor rpoD OS=Thermotoga mar... [more]
RPOD_STRAU4.658e-1634.38RNA polymerase sigma factor rpoD OS=Streptomyces a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_12E04_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-12E04-J8-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671680 ID=CX671680|Name=CX671680|organism=Citrus sinensis|type=EST|length=778bp
CTTCATCTCCAACTCACTCAACACTCCCTTCTCTCAAAACCCTTCACCCT
CTCCCCCCTCCATCACTCTCCTCTTCTCCATCTTCTTGCCTAACAAATAC
AATATAAATATTAACTTAGTCACCAATGAAGCACTTGCACTACACCCTGT
CATTGAATCAGCAACTGATGCCGCGGCATTGGCAAGCGCGGCAGTGCGTA
CTGCCAAAGATGCTGTGTCATTTGCTAATGGGGCTGAAGAGGTTTGCTTT
GATGATGGAGAATGTGAGAGTGTGTTGAAAATGATGAGGAGGAGAAGCAG
GAGAAAGAAAAGGACGAAAGAGAGTGATTTTTTGGATAAAGAAAATGGGG
AACTTGATTATAATTTGGTGAAGTGTAAGACGTCTAATTTGTATTTGACC
CCTAGTGAGGAGGCTGAAATTTGTTACTCTCTCAAGGAGGGAGCAAAGCT
GGAAGAAGCTAGAAAAACAGTTGCACAAGCTGAAGAACATGAATCAATCT
CAAAGCAGTTGGCTAAGGCCACAGGGATGAAACAAAGCAAAGTGGATAAG
ATTCTGTGTAAAGAAAGAGAATCGCAAGAGAGGATCATTCGAAGCTATCG
CAGCCTTGTTGTCTCTATAGCCACTGGTTATCAAGGCAAAGGATTAAGCC
TCAAAGATCTCATTCAGGAAGGGAGCATAGGGCTTCTTCGAGGGGCAAAA
AGATTCAATCCAGAGAGAGGATATAAGTTGTCAACTTATGTTTACTGGTG
GATTAAACAAGCTATTATTAGAACCATA
back to top