CX671678

Overview
NameCX671678
Unique NameCX671678
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NCBP1_ARATH (Nuclear cap-binding protein subunit 1 OS=Arabidopsis thaliana GN=ABH1 PE=1 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 1.222e-85
Identity = 150/217 (69.12%), Postives = 183/217 (84.33%), Query Frame = 1
Query:  115 MSSWKNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEEDDESGKGLVEKDF 765
            MS+WK LLL+IG+  PEYG S D KDHIETCFGVIRRE+E S D V  +++ CAEQ+PHKIPLYGTL+GLLNLENEDFV+K+VE+    FQ ALDSGNC+ IRIL+RF+T ++CSK++QP SL+VVFETLLSSAATTVDE+KGNPSWQ +ADFYV CILS LPWGG+EL EQVP+EIERV+ G++AYLSIR+++S +GL+FF  + E    L EKDF
Sbjct:    1 MSNWKTLLLRIGEKGPEYGTSSDYKDHIETCFGVIRREIERSGDQVLPFLLQCAEQLPHKIPLYGTLIGLLNLENEDFVQKLVESVHANFQVALDSGNCNSIRILLRFMTSLLCSKVIQPASLIVVFETLLSSAATTVDEEKGNPSWQPQADFYVICILSSLPWGGSELAEQVPDEIERVLVGIQAYLSIRKNSSTSGLNFF-HNGEFESSLAEKDF 216          
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NCBP1_ORYSJ (Nuclear cap-binding protein subunit 1 OS=Oryza sativa subsp. japonica GN=ABH1 PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.830e-73
Identity = 128/216 (59.26%), Postives = 164/216 (75.93%), Query Frame = 1
Query:  118 SSWKNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEEDDESGKGLVEKDF 765
            + W+ LLL+IGD CPEYG S D K+HIETC+GV+ RE EHS D +  +++ CA+Q+PHKIP +G L+GL+NLENEDF K +V+TT    QDAL + N DRIRIL+RFL  +MCSK++ P S++  FE LLSSAAT +DE+ GNPSWQ RADFYV CIL+ LPWGG+EL EQVP+E ERV+ G+++Y+SIRRH  D   S FE D+  G    +KDF
Sbjct:    3 AGWRTLLLRIGDRCPEYGGSADHKEHIETCYGVLCREYEHSKDAMFEFLLQCADQLPHKIPFFGVLIGLINLENEDFSKGIVDTTHANLQDALHNENRDRIRILLRFLCGLMCSKVVLPNSIIETFEALLSSAATILDEETGNPSWQPRADFYVYCILASLPWGGSELFEQVPDEFERVLVGIQSYISIRRHFDDIAFSVFETDE--GNSPNKKDF 216          
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NCBP1_HUMAN (Nuclear cap-binding protein subunit 1 OS=Homo sapiens GN=NCBP1 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 8.918e-20
Identity = 60/190 (31.58%), Postives = 103/190 (54.21%), Query Frame = 1
Query:  127 KNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHT 696
            ++L+ K+G+      ++  L+ ++E   GV+  +L +    +   +   A  +P K+ +Y TLVGLLN  N +F  + VE   R+ +++L + N +    L+RFL+ ++   ++   S+V +FE  +S    T +ED      Q R D+YV   LS LPW G EL E+   E++R+ A  E+YL  R+ T
Sbjct:   32 ESLICKVGEK-----SACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVS---VTQEEDVP----QVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKT 209          
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NCBP1_RAT (Nuclear cap-binding protein subunit 1 OS=Rattus norvegicus GN=Ncbp1 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.987e-19
Identity = 59/190 (31.05%), Postives = 103/190 (54.21%), Query Frame = 1
Query:  127 KNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHT 696
            ++L+ K+G+      ++  L+ ++E   GV+  +L +    +   +   A  +P K+ +Y TLVGLLN  N +F  + VE   R+ +++L + N +    L+RFL+ ++   ++   S+V +FE  +S    T +ED      Q R D+YV   LS LPW G EL E+   E++R+ +  E+YL  R+ T
Sbjct:   32 ESLICKVGEK-----SACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVS---VTQEEDVP----QVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFSSTESYLKRRQKT 209          
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NCBP1_MOUSE (Nuclear cap-binding protein subunit 1 OS=Mus musculus GN=Ncbp1 PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 3.389e-19
Identity = 59/190 (31.05%), Postives = 103/190 (54.21%), Query Frame = 1
Query:  127 KNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHT 696
            ++L+ K+G+      ++  L+ ++E   GV+  +L +    +   +   A  +P K+ +Y TLVGLLN  N +F  + VE   R+ +++L + N +    L+RFL+ ++   ++   S+V +FE  +S    T +ED      Q R D+YV   LS LPW G EL E+   E++R+ +  E+YL  R+ T
Sbjct:   32 ESLICKVGEK-----SACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVS---VTQEEDVP----QVRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFSTTESYLKRRQKT 209          
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NCBP1_ANOGA (Nuclear cap-binding protein subunit 1 OS=Anopheles gambiae GN=Cbp80 PE=3 SV=4)

HSP 1 Score: 90.5077 bits (223), Expect = 1.090e-17
Identity = 54/201 (26.87%), Postives = 104/201 (51.74%), Query Frame = 1
Query:  127 KNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEED 729
            + L+L++G+N     ++  L+ ++E    V+  +L +    +   + +C  ++P K  +Y T+VGL+N +N +F  + VE   + F+D+L     D  R  +RFL  ++   ++   SL+ + ++++ +A    +ED      Q R D+YV  +LS LPW G EL E+    +E ++  +E +L+ R       L  +  D
Sbjct:   35 ETLILRVGEN-----STSSLESNLEGLVSVLESDLGNFRSKILRILSDCPIKMPEKCTIYSTMVGLMNAKNYNFGGEFVEYMVKTFKDSLKQCQWDAARYALRFLADLVNCHVISTNSLLQLLDSMVDAA----NEDNVP---QVRRDWYVFAVLSTLPWVGRELYEKKESALENLLVRIEVFLNKRTKKHHNALRVWSVD 223          
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NCBP1_XENTR (Nuclear cap-binding protein subunit 1 OS=Xenopus tropicalis GN=ncbp1 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.424e-17
Identity = 56/188 (29.79%), Postives = 101/188 (53.72%), Query Frame = 1
Query:  127 KNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRR 690
            ++L+ ++G+      ++  L+ ++E   GV+  +L +    +   + + A  +P K+ +Y TLVGLLN  N +F  + VE   R  ++ +     +    L+RFL  ++   ++   S+V +FE   S    T +ED      Q R+D+YV  +LS LPW G EL E+   E++R+++ +EAYL  R+
Sbjct:   32 ESLICRVGEK-----STSSLESNLEGLAGVLEADLPNYKSKILRILCSVARTLPEKMTVYTTLVGLLNARNYNFGGEFVEAMIRHLKETIKLNAYNEAVYLVRFLCDLVNCHVIAAPSMVAMFE---SFVGVTQEEDIP----QVRSDWYVYAVLSSLPWVGKELYEKKDVEMDRILSQIEAYLKQRQ 207          
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NBP1A_XENLA (Nuclear cap-binding protein subunit 1-A OS=Xenopus laevis GN=ncbp1-A PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.429e-17
Identity = 56/188 (29.79%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  127 KNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRR 690
            ++L+ ++G+      ++  L+ ++E   GV+  +L +    +   +   A  +P K+ +Y TLVGLLN  N +F  + VE   R  ++ +          L+RFL+ ++   ++   S+V +FE   S    T +ED      Q R+D+YV  +LS LPW G EL E+   E++R+++ +EAYL  R+
Sbjct:   32 ESLICRVGEK-----STSSLESNLEGLAGVLEADLPNYKSKILRILCFVARLLPEKMSVYSTLVGLLNARNYNFGGEFVEAMIRHLKETIKLNAYSEAVYLVRFLSDLVNCHVIAAPSMVAMFE---SFVGVTQEEDIP----QVRSDWYVYAVLSSLPWVGKELYEKKDVEMDRILSQIEAYLKQRQ 207          
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NCBP1_AEDAE (Nuclear cap-binding protein subunit 1 OS=Aedes aegypti GN=Cbp80 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.143e-17
Identity = 53/201 (26.37%), Postives = 103/201 (51.24%), Query Frame = 1
Query:  127 KNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEED 729
            + L+L++G+N     +S  L+ ++E    V+  +L +    +   +  C  ++P K  +Y T+VGL+N +N +F  + V+   + F+++L     D  R  +RFL+ ++   ++   SL+ + + ++ +A    +ED      Q R D+YV  +LS LPW G EL E+    +E ++  +E +L+ R       L  +  D
Sbjct:   35 ETLILRVGEN-----SSSSLESNLEGLVSVLESDLGNFRSKILRILSECPIKMPEKCTIYSTMVGLMNAKNYNFGGEFVDHMVKTFKESLKQCRWDAARYALRFLSDLVNCHVISTNSLLQLLDNMVDAA----NEDSVP---QVRRDWYVFAVLSTLPWVGRELYEKKESALENLLVRIEVFLNKRTKKHHNSLRVWSVD 223          
BLAST of CX671678 vs. ExPASy Swiss-Prot
Match: NCBP1_CHICK (Nuclear cap-binding protein subunit 1 OS=Gallus gallus GN=NCBP1 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.410e-17
Identity = 55/188 (29.26%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  127 KNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSFDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRR 690
            ++L+ ++G+      ++  L+ ++E   GV+  +L +    +   +   A  +P K+ +Y TLVGLLN  N +F  + VE   R+ ++ L     +    L+RFL+ ++   ++   S+V +FE  +S    T +ED      Q R D+Y+   LS LPW G EL E+   E++R+++  E+YL  R+
Sbjct:   34 ESLICRVGEK-----SNSSLESNLEGLAGVLEADLPNYKSKILRILCTVARLLPEKLTVYTTLVGLLNARNYNFGGEFVEAMIRQLKECLKVNMYNEAVHLVRFLSDLVNCHVIAAPSMVAMFENFVS---VTQEEDVP----QVRCDWYIFAFLSSLPWVGKELYEKKDAEMDRLLSQTESYLKRRQ 209          
The following BLAST results are available for this feature:
BLAST of CX671678 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
NCBP1_ARATH1.222e-8569.12Nuclear cap-binding protein subunit 1 OS=Arabidops... [more]
NCBP1_ORYSJ1.830e-7359.26Nuclear cap-binding protein subunit 1 OS=Oryza sat... [more]
NCBP1_HUMAN8.918e-2031.58Nuclear cap-binding protein subunit 1 OS=Homo sapi... [more]
NCBP1_RAT1.987e-1931.05Nuclear cap-binding protein subunit 1 OS=Rattus no... [more]
NCBP1_MOUSE3.389e-1931.05Nuclear cap-binding protein subunit 1 OS=Mus muscu... [more]
NCBP1_ANOGA1.090e-1726.87Nuclear cap-binding protein subunit 1 OS=Anopheles... [more]
NCBP1_XENTR1.424e-1729.79Nuclear cap-binding protein subunit 1 OS=Xenopus t... [more]
NBP1A_XENLA2.429e-1729.79Nuclear cap-binding protein subunit 1-A OS=Xenopus... [more]
NCBP1_AEDAE4.143e-1726.37Nuclear cap-binding protein subunit 1 OS=Aedes aeg... [more]
NCBP1_CHICK5.410e-1729.26Nuclear cap-binding protein subunit 1 OS=Gallus ga... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_12E03_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-12E03-J6-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671678 ID=CX671678|Name=CX671678|organism=Citrus sinensis|type=EST|length=765bp
GTTCAAGTTAATTGGAATCCAATTTGCCACTAAACCCTGCAAATCCCCTT
CTTCTTACTAAACTGCTGGCTCTTCCTCTGCTTCTGCTTCTCTCACGGAA
CAAGAGATTAAGAAATGAGCAGCTGGAAGAACCTTCTGCTTAAAATCGGG
GACAATTGTCCGGAGTACGGCAACTCCGACGACTTGAAGGATCACATTGA
AACATGCTTCGGCGTAATTCGGCGAGAACTCGAGCACTCTTTTGACGATG
TTCCACATTATATTATTAATTGTGCTGAGCAAATTCCACACAAGATTCCT
TTATATGGGACATTGGTTGGCTTGCTGAACTTGGAAAATGAGGACTTTGT
TAAAAAAGTTGTGGAGACCACTCAAAGAAAATTCCAGGATGCCTTAGACT
CTGGAAACTGCGACCGCATTCGTATTTTGATGCGATTTTTGACTGTTATG
ATGTGTAGCAAAATTCTCCAGCCTGGTTCTCTGGTGGTGGTCTTTGAAAC
TTTATTGTCATCAGCTGCCACAACAGTGGATGAGGACAAAGGAAATCCTT
CCTGGCAAGCACGTGCTGACTTTTATGTAACTTGCATTTTGTCTTGTCTC
CCATGGGGAGGAGCAGAACTCATTGAGCAAGTTCCTGAGGAAATTGAGAG
AGTCATGGCTGGTTTGGAAGCCTACTTGAGCATTAGAAGGCATACTTCTG
ACACCGGTCTGTCTTTCTTTGAGGAAGATGATGAATCTGGGAAAGGTCTT
GTTGAAAAGGATTTC
back to top