CX671670

Overview
NameCX671670
Unique NameCX671670
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length847
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5082 contig Csv1_Contig5082:380..1226. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK11_ARATH (Probable serine/threonine-protein kinase WNK11 OS=Arabidopsis thaliana GN=WNK11 PE=2 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 5.324e-125
Identity = 209/257 (81.32%), Postives = 234/257 (91.05%), Query Frame = 3
Query:   75 NSDPSDKDSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRTFCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            N    DKDSE F+E DPTGRYGRY ELLGSGAVKKVYRAFDQEEGIEVAWNQVKLR F DDPAM ERL+SEVRLLK L N NII+L+ VWRDE  NTLNFITE+CTSGNLREYRKKHRHVS++ALKKWSKQILKGL+YLHTH+PC+IHRDLNCSN+FVNGN GQVKIGDLG+AAIVGK+H AHS+LGTPEFMAPELY+E+YTE+VDIYS+GMCVLE+V+LEIPYSECD+VAKIYK+VS G +P+ALNK+ DPE K F
Sbjct:   10 NESEKDKDSESFVEVDPTGRYGRYGELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRCFSDDPAMTERLYSEVRLLKNLKNSNIITLYKVWRDERNNTLNFITEICTSGNLREYRKKHRHVSMRALKKWSKQILKGLDYLHTHDPCIIHRDLNCSNIFVNGNIGQVKIGDLGLAAIVGKNHLAHSILGTPEFMAPELYEENYTEMVDIYSYGMCVLELVSLEIPYSECDSVAKIYKRVSKGLKPEALNKVNDPEAKAF 266          
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK5_ORYSJ (Probable serine/threonine-protein kinase WNK5 OS=Oryza sativa subsp. japonica GN=WNK5 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.507e-103
Identity = 177/257 (68.87%), Postives = 216/257 (84.05%), Query Frame = 3
Query:   78 SDPSDKDSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRTFCD-DPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            S  + ++ E F E DPTGR+GRY ++LG G+VKKVYR FDQEEGIEVAWN+V+LR   D DPAM+ERL +EVRLL++L +++II  H VW D D   LNFITEVCTSG+LREYR +HRHVSVKALKKW++QIL GL++LHTH+PC+IHRDLNCSNVF+NGNTGQVKIGDLG+AAIV K+H AH++LGTPEFMAPELY E YTE VDIYS+GMCVLEMVT E+PY+ECD+V +IY  V+ G  P AL +I+DPE++ F
Sbjct:   35 SASAGEEEEAFEEVDPTGRFGRYADVLGLGSVKKVYRGFDQEEGIEVAWNRVRLRALADRDPAMVERLHAEVRLLRSLHHEHIIGFHKVWLDRDAGVLNFITEVCTSGSLREYRDRHRHVSVKALKKWARQILLGLDHLHTHDPCIIHRDLNCSNVFINGNTGQVKIGDLGLAAIVDKTHVAHTILGTPEFMAPELYTETYTESVDIYSYGMCVLEMVTREMPYAECDSVVQIYHSVTRGVPPAALKRIRDPELRAF 291          
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK1_ARATH (Serine/threonine-protein kinase WNK1 OS=Arabidopsis thaliana GN=WNK1 PE=1 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 2.849e-94
Identity = 161/252 (63.89%), Postives = 201/252 (79.76%), Query Frame = 3
Query:   90 DKDSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRTFCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            + D   F+E DPTGRYGRYNE+LG GA K VYRAFD+ EGIEVAWNQVKL  F   P  +ERL+ E+ LLKTL +KNI+  +  W D     +NF+TE+ TSG LR+YR +H+ V+++A+K W +QIL+GL+YLH+H+P VIHRDL C N+FVNGN G+VKIGDLG+AAI+ KSH+AH  +GTPEFMAPE+Y+E Y ELVDIYSFGMC+LEMVT + PYSEC + A+IYKKV SG++PDAL K+KDPEVK F
Sbjct:    8 EPDYSEFVEVDPTGRYGRYNEVLGKGASKTVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTANRNINFVTELFTSGTLRQYRLRHKRVNIRAMKHWCRQILRGLHYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAILRKSHAAH-CVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFDYPYSECTHPAQIYKKVMSGKKPDALYKVKDPEVKCF 258          
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK2_ORYSJ (Probable serine/threonine-protein kinase WNK2 OS=Oryza sativa subsp. japonica GN=WNK2 PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 1.414e-93
Identity = 164/251 (65.34%), Postives = 199/251 (79.28%), Query Frame = 3
Query:   96 DSEP-FIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRTFCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            D+EP F E DPT RYGRY E+LG GA K VY+AFDQ EG+EVAWNQ+K+     +   +ERL SEVRLLKTL +KNII  +  W D+  N +NFITEV TSG LR+YR KH+ V V+ALKKWS+QIL GL YLH+H+P VIHRDL C N+FVNGN G+VKIGDLG+A I+  + SAHS++GTPEFMAPELYDE+Y ELVDIY+FGMC+LE+VT E PY EC N A+IYKKVS G++P +L KI+DPEV+ F
Sbjct:   13 DTEPEFAEVDPTARYGRYTEVLGKGAFKTVYKAFDQLEGLEVAWNQIKVGDILRNNDDLERLRSEVRLLKTLKHKNIIKFYNSWLDKKNNNINFITEVFTSGTLRQYRIKHKKVDVRALKKWSRQILSGLVYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLATILDNARSAHSIIGTPEFMAPELYDEEYNELVDIYAFGMCLLELVTFEYPYCECSNAAQIYKKVSDGEKPSSLAKIEDPEVRFF 263          
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK3_ARATH (Probable serine/threonine-protein kinase WNK3 OS=Arabidopsis thaliana GN=WNK3 PE=2 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 9.166e-93
Identity = 163/253 (64.43%), Postives = 202/253 (79.84%), Query Frame = 3
Query:   90 DKDSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRT-FCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            +   E F+E DPTGRYGRY E+LG GA K+VYRAFDQ EGIEVAWNQVKL   FC    + +RL+SEV LLKTL +K+II  +  W D    T+N ITEV TSGNLR+YRKKH+ V ++ALKKWS+QIL+GL YLH+H+P VIHRDL C N+F+NGN G+VKIGDLG+AAI+ ++ SAHS++GTPEFMAPELY+EDY  LVDIY+FGMC+LE+VT E PYSEC N A+IY+KV+SG +P AL  + DP+V+ F
Sbjct:    6 NNSEEEFVEIDPTGRYGRYKEVLGKGAFKEVYRAFDQLEGIEVAWNQVKLDDKFCSSEDL-DRLYSEVHLLKTLKHKSIIKFYTSWIDHQHMTINLITEVFTSGNLRQYRKKHKCVDLRALKKWSRQILEGLVYLHSHDPPVIHRDLKCDNIFINGNQGEVKIGDLGLAAILHRARSAHSVIGTPEFMAPELYEEDYNVLVDIYAFGMCLLELVTFEYPYSECTNAAQIYRKVTSGIKPAALLNVTDPQVRAF 257          
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK9_ARATH (Probable serine/threonine-protein kinase WNK9 OS=Arabidopsis thaliana GN=WNK9 PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 1.197e-92
Identity = 154/252 (61.11%), Postives = 199/252 (78.97%), Query Frame = 3
Query:   90 DKDSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRTFCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            + D   ++E DPTGRYGRYNE+LG G+ K VYR FD+ +GIEVAWNQVKL  F   P  +ERL+ E+ LLKTL +K+I+  +  W D D   +NF+TE+ TSG LR+YR KH+ V+++A+K W +QIL+GLNYLHTH+P VIHRDL C N+F+NGN G+VKIGDLG+AA +  SH+AH  +GTPEFMAPE+Y E+Y +LVDIYSFGMCVLEMVT + PYSEC + A+IYK+V SG++PD L+K+KDPEV+ F
Sbjct:    9 ESDYSEYVEVDPTGRYGRYNEVLGKGSSKTVYRGFDEYQGIEVAWNQVKLYDFLQSPQELERLYCEIHLLKTLKHKSIMKFYASWVDTDNRNINFVTEMFTSGTLRQYRLKHKRVNIRAVKNWCRQILRGLNYLHTHDPPVIHRDLKCDNIFINGNQGEVKIGDLGLAACLQHSHAAH-CVGTPEFMAPEVYKEEYNQLVDIYSFGMCVLEMVTFDYPYSECSHPAQIYKRVISGKKPDGLDKVKDPEVRGF 259          
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK2_ARATH (Serine/threonine-protein kinase WNK2 OS=Arabidopsis thaliana GN=WNK2 PE=1 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 6.569e-91
Identity = 153/251 (60.96%), Postives = 201/251 (80.08%), Query Frame = 3
Query:   93 KDSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRTFCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            +D   F+E DP+GRYGRY+E+LG GA K VYRAFD+ EGIEVAWNQVKLR F  +P  +E+ F E+ LLKTL ++NI+  +  W D +  ++NF+TE+ TSG LR+YR +HR V+++A+K+W KQILKGL YLH+  P +IHRDL C N+F+NGN G+VKIGDLG+AAI+ KSH+    +GTPEFMAPE+YDE+Y ELVD+Y+FGMCVLEMVT + PYSEC + A+IYKKV+SG++P+A   +KDPEV+EF
Sbjct:    9 EDCSVFVEIDPSGRYGRYDEILGKGASKTVYRAFDEYEGIEVAWNQVKLRNFTRNPEELEKFFREIHLLKTLNHQNIMKFYTSWVDTNNLSINFVTELFTSGTLRQYRLRHRRVNIRAVKQWCKQILKGLLYLHSRSPPIIHRDLKCDNIFINGNQGEVKIGDLGLAAILRKSHAVR-CVGTPEFMAPEVYDEEYNELVDVYAFGMCVLEMVTFDYPYSECTHPAQIYKKVTSGKKPEAFYLVKDPEVREF 258          
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK1_ORYSJ (Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. japonica GN=WNK1 PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.911e-90
Identity = 155/250 (62.00%), Postives = 195/250 (78.00%), Query Frame = 3
Query:   96 DSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRTFCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            D   + E DPTGRYGRYN++LG GA K VYRAFD+ +G+EVAWNQVKL  F   P  +ERL+ E+ LLKTL ++NI+  +  W D  R  +NFITE+ TSG LR+YR+KH  V++ A+K W +QIL GL YLH+H+P +IHRDL C N+FVNGN G+VKIGDLG+AAI+ KSH+ H  +GTPEFMAPE+Y+E+Y ELVDIYSFGMCVLEMVT E PYSEC +  +IYKKV SG +P+AL K+KDP V++F
Sbjct:   13 DLPEYAEVDPTGRYGRYNDVLGKGASKTVYRAFDEYQGMEVAWNQVKLHDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDVSRRNINFITEMFTSGTLRQYRQKHMRVNIWAVKHWCRQILSGLLYLHSHDPPIIHRDLKCDNIFVNGNQGEVKIGDLGLAAILRKSHAVH-CVGTPEFMAPEVYEEEYNELVDIYSFGMCVLEMVTFEYPYSECTHPVQIYKKVISGTKPEALYKVKDPMVRQF 261          
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK1_ORYSI (Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. indica GN=WNK1 PE=2 SV=2)

HSP 1 Score: 332.413 bits (851), Expect = 1.911e-90
Identity = 155/250 (62.00%), Postives = 195/250 (78.00%), Query Frame = 3
Query:   96 DSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRTFCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            D   + E DPTGRYGRYN++LG GA K VYRAFD+ +G+EVAWNQVKL  F   P  +ERL+ E+ LLKTL ++NI+  +  W D  R  +NFITE+ TSG LR+YR+KH  V++ A+K W +QIL GL YLH+H+P +IHRDL C N+FVNGN G+VKIGDLG+AAI+ KSH+ H  +GTPEFMAPE+Y+E+Y ELVDIYSFGMCVLEMVT E PYSEC +  +IYKKV SG +P+AL K+KDP V++F
Sbjct:   13 DLPEYAEVDPTGRYGRYNDVLGKGASKTVYRAFDEYQGMEVAWNQVKLHDFLQSPEDLERLYCEIHLLKTLKHRNIMKFYTSWVDVSRRNINFITEMFTSGTLRQYRQKHMRVNIWAVKHWCRQILSGLLYLHSHDPPIIHRDLKCDNIFVNGNQGEVKIGDLGLAAILRKSHAVH-CVGTPEFMAPEVYEEEYNELVDIYSFGMCVLEMVTFEYPYSECTHPVQIYKKVISGTKPEALYKVKDPMVRQF 261          
BLAST of CX671670 vs. ExPASy Swiss-Prot
Match: WNK5_ARATH (Probable serine/threonine-protein kinase WNK5 OS=Arabidopsis thaliana GN=WNK5 PE=1 SV=2)

HSP 1 Score: 324.709 bits (831), Expect = 3.985e-88
Identity = 158/256 (61.72%), Postives = 199/256 (77.73%), Query Frame = 3
Query:   78 SDPSDKDSEPFIETDPTGRYGRYNELLGSGAVKKVYRAFDQEEGIEVAWNQVKLRTFCDDPAMIERLFSEVRLLKTLANKNIISLHYVWRDEDRNTLNFITEVCTSGNLREYRKKHRHVSVKALKKWSKQILKGLNYLHTHEPCVIHRDLNCSNVFVNGNTGQVKIGDLGVAAIVGKSHSAHSMLGTPEFMAPELYDEDYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYKKVSSGQRPDALNKIKDPEVKEF 845
            S  SD DS  ++ETDP+GRYGR+ E+LG GA+K VY+AFDQ  G+EVAWNQVKL      P  ++RL+SEV LLK L +++II     W D +R T NFITE+ TSG LREYR+K++ V ++A+K W++QIL GL YLH H+P VIHRDL C N+FVNG+ GQVKIGDLG+AAI+  S +AHS++GTPEFMAPELY+EDY ELVDIYSFGMCVLEM+T E PYSEC N A+IYKKV+SG+ PD+ + I+  E + F
Sbjct:    6 SSASD-DSIAYVETDPSGRYGRFREVLGKGAMKTVYKAFDQVLGMEVAWNQVKLNEVFRSPEPLQRLYSEVHLLKNLNHESIIRYCTSWIDVNRRTFNFITELFTSGTLREYRRKYQKVDIRAIKSWARQILNGLAYLHGHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLAAILRGSQNAHSVIGTPEFMAPELYEEDYNELVDIYSFGMCVLEMLTGEYPYSECTNPAQIYKKVTSGKLPDSFHLIQHTEAQRF 260          
The following BLAST results are available for this feature:
BLAST of CX671670 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
WNK11_ARATH5.324e-12581.32Probable serine/threonine-protein kinase WNK11 OS=... [more]
WNK5_ORYSJ1.507e-10368.87Probable serine/threonine-protein kinase WNK5 OS=O... [more]
WNK1_ARATH2.849e-9463.89Serine/threonine-protein kinase WNK1 OS=Arabidopsi... [more]
WNK2_ORYSJ1.414e-9365.34Probable serine/threonine-protein kinase WNK2 OS=O... [more]
WNK3_ARATH9.166e-9364.43Probable serine/threonine-protein kinase WNK3 OS=A... [more]
WNK9_ARATH1.197e-9261.11Probable serine/threonine-protein kinase WNK9 OS=A... [more]
WNK2_ARATH6.569e-9160.96Serine/threonine-protein kinase WNK2 OS=Arabidopsi... [more]
WNK1_ORYSJ1.911e-9062.00Probable serine/threonine-protein kinase WNK1 OS=O... [more]
WNK1_ORYSI1.911e-9062.00Probable serine/threonine-protein kinase WNK1 OS=O... [more]
WNK5_ARATH3.985e-8861.72Probable serine/threonine-protein kinase WNK5 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_12D11_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-12D11-H22-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671670 ID=CX671670|Name=CX671670|organism=Citrus sinensis|type=EST|length=847bp
CTGTGAACTGCTTTTTCGCAAATAAAGCTTCCGCTTCTCCATTCTTTATT
TGCTTTTTCATGATGCCGGCTGTTAACTCGGATCCATCCGACAAAGACTC
CGAGCCGTTTATAGAGACCGACCCCACCGGCCGATACGGCCGATACAACG
AACTACTTGGCTCCGGCGCCGTGAAGAAAGTGTACCGAGCATTTGATCAA
GAAGAGGGCATAGAAGTTGCATGGAATCAAGTGAAGCTAAGAACCTTCTG
CGACGATCCGGCGATGATCGAAAGGCTCTTCTCGGAAGTCCGTTTGCTGA
AAACCCTAGCCAACAAGAACATAATCTCCTTGCACTACGTGTGGCGCGAC
GAGGATCGCAACACATTGAATTTCATCACCGAAGTCTGCACTTCCGGTAA
CTTGAGAGAGTACCGGAAAAAGCACCGGCATGTTTCCGTGAAGGCGCTCA
AGAAATGGTCAAAGCAAATCTTGAAGGGGTTGAATTATTTGCACACGCAC
GAGCCTTGTGTCATTCATAGGGATCTCAATTGTAGCAACGTTTTCGTCAA
CGGAAACACTGGCCAGGTTAAGATCGGTGATCTCGGGGTGGCGGCGATAG
TGGGAAAGAGCCATTCGGCGCATTCGATGCTGGGGACGCCGGAGTTCATG
GCGCCGGAGCTGTACGATGAGGATTACACGGAGCTTGTGGACATATACTC
GTTTGGGATGTGCGTGCTAGAGATGGTGACGTTGGAGATACCTTACAGCG
AATGCGACAATGTGGCCAAAATTTACAAGAAGGTGTCGTCTGGGCAGAGG
CCTGATGCATTGAACAAGATTAAGGATCCAGAGGTAAAGGAGTTCAT
back to top