CX671667

Overview
NameCX671667
Unique NameCX671667
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length902
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX671667_ssr419 microsatellite CX671667_ssr419:419..433. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5941 contig Csv1_Contig5941:75..976. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671667 vs. ExPASy Swiss-Prot
Match: 7SB1_SOYBN (Basic 7S globulin OS=Glycine max GN=BG PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 1.151e-27
Identity = 100/294 (34.01%), Postives = 137/294 (46.60%), Query Frame = -2
Query:  104 GDLAEDTIAVR----SELEDPSITAVDQFLFSCAPTFXXXXXXXXXXXXXXXXXA-PISLPSQLATGIGHQRKFFMCLS---SSNGVVLSHHTSTTKLP---------LMYTPL-IGKSQDYFINVKSIKING------NPLSVTIEGLTK----LSTIVPYATMESSIYXXXXXXXXXXXXXASRDMSVVAPVAPFGLCFSSKGFNGSAVPVIDFVLQSEMVK-WRIYGSNSMVKVNEEVVCLGFLDGGSDLTSSIVLGGFQLEDNVMDFDLGTSMLGFST----LRGTCCSD 886
            G+L ED +A+     S  +   +  V QFLFSCAP+F                   PISLP+QLA+  G QR+F  CLS   +S G ++                   L +TPL I    +Y + V SI+IN       N +S TI G T     +ST  P+  ++ S+Y              ++    V  VAPFGLCF+S   N  A P +D V+       WRI G + MV+    V CLG ++GG    + I LG  QLE+N++ FDL  S +GFST      G  C+D
Sbjct:  133 GELGEDVLAIHATQGSTQQLGPLVTVPQFLFSCAPSFLVQKGLPRNTQGVAGLGHAPISLPNQLASHFGLQRQFTTCLSRYPTSKGAIIFGDAPNNMRQFQNQDIFHDLAFTPLTITLQGEYNVRVNSIRINQHSVFPLNKISSTIVGSTSGGTMISTSTPHMVLQQSVYQAFTQVFAQQLPKQAQ----VKSVAPFGLCFNSNKIN--AYPSVDLVMDKPNGPVWRISGEDLMVQAQPGVTCLGVMNGGMQPRAEITLGARQLEENLVVFDLARSRVGFSTSSLHSHGVKCAD 420          
BLAST of CX671667 vs. ExPASy Swiss-Prot
Match: 7SBG2_SOYBN (Basic 7S globulin 2 OS=Glycine max PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 9.747e-27
Identity = 98/293 (33.45%), Postives = 135/293 (46.08%), Query Frame = -2
Query:  104 GDLAEDTIAVR----SELEDPSITAVDQFLFSCAPTFXXXXXXXXXXXXXXXXXA-PISLPSQLATGIGHQRKFFMCLS---SSNGVVL---------SHHTSTTKLPLMYTPLIGKSQ-DYFINVKSIKING------NPLSVTIEGL---TKLSTIVPYATMESSIYXXXXXXXXXXXXXASRDMSVVAPVAPFGLCFSSKGFNGSAVPVIDFVLQSEMVK-WRIYGSNSMVKVNEEVVCLGFLDGGSDLTSSIVLGGFQLEDNVMDFDLGTSMLGFST----LRGTCCSD 886
            G+L +D +A+     S  +   +  V QFLFSCAP+F                   PISLP+QLA+  G Q +F  CLS   +S G ++           H       L +TPL    Q +Y + V SI+IN       N +S TI G    T +ST  P+  ++ S+Y              ++    V  VAPFGLCF+S   N  A P +D V+       WRI G + MV+    V CLG ++GG    + + LG  QLE+ +M FDL  S +GFST      G  C D
Sbjct:  140 GELGQDVLAIHATQGSTQQLGPLVTVPQFLFSCAPSFLLQKGLPRNIQGVAGLGHAPISLPNQLASHFGLQHQFTTCLSRYPTSKGALIFGDAPNNMQQFHNQDIFHDLAFTPLTVTPQGEYNVRVSSIRINQHSVFPPNKISSTIVGSSGGTMISTSTPHMVLQQSLYQAFTQVFAQQLEKQAQ----VKSVAPFGLCFNSNKIN--AYPSVDLVMDKPNGPVWRISGEDLMVQAQPGVTCLGVMNGGMQPRAEVTLGTRQLEEKLMVFDLARSRVGFSTSSLHSHGVKCGD 426          
The following BLAST results are available for this feature:
BLAST of CX671667 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
7SB1_SOYBN1.151e-2734.01Basic 7S globulin OS=Glycine max GN=BG PE=1 SV=2[more]
7SBG2_SOYBN9.747e-2733.45Basic 7S globulin 2 OS=Glycine max PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_12D10_b Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-12D10-H20-6.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671667 ID=CX671667|Name=CX671667|organism=Citrus sinensis|type=EST|length=902bp
TTTTTTTTTTTTTTTTTACAAAAAGATCAGTGTACGTAGTATTCCGCTAC
AATATAATTAATAATAATCACAAGGACTCGTCAAGCACAGAATTAGGTGA
AAAATCGGAACAACACGTTCCCCTCAAAGTGCTAAATCCTAGCATAGAAG
TACCTAAATCAAAATCCATAACATTATCCTCCAACTGAAATCCACCTAAC
ACAATTGAGCTGGTCAAGTCAGAGCCACCGTCCAAGAAACCCAAGCACAC
CACCTCCTCATTCACCTTCACCATAGAATTGGACCCATAAATCCTCCACT
TCACCATTTCACTCTGCAACACAAAGTCAATAACCGGCACCGCTGACCCA
TTAAACCCTTTTGAGCTAAAACAGAGACCGAATGGAGCCACGGGAGCCAC
CACGCTCATGTCCCTAGAAGCAGCAGCAGCAGCCTTCATGAAAGCTTTGG
CAAATGTGGCATAAATTGAGCTCTCCATAGTCGCGTAAGGAACAATTGTG
CTCAATTTTGTCAATCCTTCGATAGTAACCGATAATGGGTTGCCATTTAT
TTTGATGGATTTGACATTAATGAAGTAATCTTGAGACTTACCAATAAGAG
GTGTGTACATCAGTGGCAACTTTGTTGTGCTTGTATGGTGAGACAATACG
ACACCGTTTGAAGATGAGAGACACATAAAGAACTTTCTTTGATGGCCGAT
TCCGGTGGCGAGCTGTGACGGTAGTGAAATTGGAGCCCTTCCCAGGCCCA
GCATTCCTCTGGCACCCCTTGCAAGGCCTTGGAGGAGAAAAGTTGGCGCA
CAAGAGAAGAGGAACTGATCAACGGCTGTGATTGATGGGTCCTCTAGTTC
TGATCGAACGGCTATGGTGTCTTCCGCCAAATCCCCTGTAGTGACCAATC
CT
back to top