CX043365

Overview
NameCX043365
Unique NameCX043365
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length776
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX043365 vs. ExPASy Swiss-Prot
Match: ANTA_GENTR (Anthocyanin 5-aromatic acyltransferase OS=Gentiana triflora PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.869e-33
Identity = 84/243 (34.57%), Postives = 131/243 (53.91%), Query Frame = 2
Query:   50 ESSYRVRVVDESHVGPPRGSVS-PTTIPLTFLDMVWISIGPMQRIFFYEFPDISTPHFTQNIYPNLKHSLSLTLRHFFPFAANLTCP----PPPNHPYISYKEGDSVLVSVAESDYDFDHLTANQARDNNAFHQSLVPKLPTPSLLSEETHAVPTMAVQFTVFPNSGFSIGIAFNHVAADGRSLNHFVKSWASMSVTHRLGD------LPCHDKDLVEDPDGIASIYLNDWRNFLKNCSASSS 745
            E    V+V+++  V PP  +     ++P+TF D+ W+ +  MQ + FY+FP   T HF   + PNLK SLSLTL+H+ P + NL  P      P   Y S  EGDS+ + VAESD DFD+L  +Q  D+N  H  L   +P      ++   +P +AVQ TVFPN G ++ +  +H  AD +S   F+ +WA ++   +  D      LP  D+ +++D  G+   + N+ ++ L+  S   S
Sbjct:    2 EQIQMVKVLEKCQVTPPSDTTDVELSLPVTFFDIPWLHLNKMQSLLFYDFPYPRT-HFLDTVIPNLKASLSLTLKHYVPLSGNLLMPIKSGEMPKFQY-SRDEGDSITLIVAESDQDFDYLKGHQLVDSNDLH-GLFYVMPRVIRTMQDYKVIPLVAVQVTVFPNRGIAVALTAHHSIADAKSFVMFINAWAYINKFGKDADLLSANLLPSFDRSIIKDLYGLEETFWNEMQDVLEMFSRFGS 241          
BLAST of CX043365 vs. ExPASy Swiss-Prot
Match: DCR_ARATH (BAHD acyltransferase DCR OS=Arabidopsis thaliana GN=DCR PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.787e-13
Identity = 59/193 (30.57%), Postives = 90/193 (46.63%), Query Frame = 2
Query:   62 RVRVVDESHVGPPRGSVSPTTIPLTFLDMVWISIGPMQRIFFYEFP---DISTPHFTQNIYPNLKHSLSLTLRHFFPFAANLTCPPPPNHPYISYKEGDS----VLVSVAES-DYDFDHLTANQARDNNAFHQSLVPKLPTPSLLSEETHAVPTMAVQFTVFPNSGFSIGIAFNHVAADGRSLNHFVKSWASM 616
            +++++ ++HV P +  +      LT  D+ +++    Q+   Y+F    D+  P F   +  NLK  L L L  F+  A  L          + Y   DS    V  SVA + D   D LTA    D  A  + LVP      +L+ E  + P +AVQ T   + G ++G+AFNH   DG S  HF+ SWA +
Sbjct:    2 KIKIMSKTHVKPTKPVLGKKQFHLTTFDLPYLAFYYNQKFLLYKFQNLLDLEEPTFQNEVVENLKDGLGLVLEDFYQLAGKLA-KDDEGVFRVEYDAEDSEINGVEFSVAHAADVTVDDLTAE---DGTAKFKELVPY---NGILNLEGLSRPLLAVQVTKLKD-GLAMGLAFNHAVLDGTSTWHFMSSWAEI 186          
The following BLAST results are available for this feature:
BLAST of CX043365 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
ANTA_GENTR1.869e-3334.57Anthocyanin 5-aromatic acyltransferase OS=Gentiana... [more]
DCR_ARATH4.787e-1330.57BAHD acyltransferase DCR OS=Arabidopsis thaliana G... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10F01_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10F01-L2-1-6.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043365 ID=CX043365; Name=CX043365; organism=Citrus sinensis; type=EST; length=776bp
CAATCTTCAAGTCAATTACTTAGTTTCCTCTGAGATGGCGACGGCAGCTG
AATCATCATACAGGGTGAGGGTTGTTGATGAAAGCCATGTTGGCCCCCCG
CGGGGCTCAGTGTCCCCAACAACTATTCCTCTCACTTTTCTGGACATGGT
ATGGATTTCTATAGGTCCCATGCAGCGTATCTTCTTCTATGAATTCCCCG
ACATCAGCACTCCTCATTTCACACAAAATATATACCCCAATCTCAAGCAC
TCACTTTCCCTCACTCTCCGGCATTTCTTCCCCTTTGCTGCCAATCTTAC
TTGTCCTCCGCCGCCGAATCACCCTTACATCTCGTACAAGGAAGGCGACT
CCGTTCTGGTCTCCGTTGCTGAATCCGACTACGATTTTGATCATCTGACA
GCTAACCAAGCCCGAGATAATAATGCGTTTCATCAGTCACTTGTTCCGAA
ACTGCCTACCCCAAGTTTGCTGTCCGAGGAAACGCACGCGGTGCCTACTA
TGGCCGTACAATTCACCGTCTTTCCAAATTCAGGCTTTTCAATCGGGATC
GCCTTCAACCACGTGGCAGCCGATGGAAGAAGTTTGAATCATTTTGTGAA
ATCTTGGGCGTCCATGTCCGTTACCCATCGGTTAGGAGACTTGCCTTGCC
ACGACAAGGATTTGGTCGAGGACCCAGATGGAATCGCTTCCATCTACTTG
AATGATTGGCGTAATTTTTTGAAGAATTGTTCGGCTTCTTCCTCTGCCGA
TAGTGGTAATGGTGTTACTCCTCCTG
back to top