CX671282

Overview
NameCX671282
Unique NameCX671282
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length832
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8493 contig Csv1_Contig8493:138..969. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 1.252e-118
Identity = 208/260 (80.00%), Postives = 225/260 (86.54%), Query Frame = 1
Query:   52 IGAKEMLGNPLNVSSAVRTSAPGASNPSTFKPVALFXXXXXXXXXXXXXXXXXXXNEELAKWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVLVGGAEYYRITNGLDLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            +G  EMLG PLN  +  R+SAP AS+PSTFK VALF                   ++ELAKWYGPDRRIFLP+GLLDRSEIPEYL GEV GDYGYDPFGL KKP++F+KYQA+ELIHARWAMLGAAGFIIPEA NK+GANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLV AV+AE+VL+GGAEYYRITNGLD EDKLHPGGPFDPLGLAKDP+Q ALLKVKEIKNGRLAMFAMLGFF+QAYVTGEGPVENLAKHLSD
Sbjct:    4 LGVSEMLGTPLNFRAVSRSSAPLASSPSTFKTVALFSKKKPAPAKSKAVSET---SDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSD 260          
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 4.385e-55
Identity = 112/207 (54.11%), Postives = 139/207 (67.15%), Query Frame = 1
Query:  232 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPIN---LVFAVIAEIVLVGGAEYYRITNG----LDLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            ++YGPDR  FL  G    ++ PEYLTGE PGDYG+D  GLS  P  F++Y+  ELIHARWA+LGA G + PE  +++      E VWFK GA +     LNY G    I+   ++  +  ++VL+G AE YR   G    LD  D L+PGGPFDPLGLA DPD FA LKVKEIKNGRLAMF+ LGFF+QA VTG+GPV+NL  HL+D
Sbjct:   32 EFYGPDRAKFL--GPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFDPLGLADDPDTFAELKVKEIKNGRLAMFSCLGFFVQAIVTGKGPVQNLTDHLAD 236          
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.194e-52
Identity = 108/204 (52.94%), Postives = 139/204 (68.14%), Query Frame = 1
Query:  235 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P++F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G    ++   + A+ A +++L+G  E YRI  G   ++ D ++PGG FDPLGLA+DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+D
Sbjct:   58 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLAD 257          
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.560e-52
Identity = 109/204 (53.43%), Postives = 137/204 (67.16%), Query Frame = 1
Query:  235 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G    I    + A+ A +++L+G  E YR+  G   ++ D ++PGG FDPLGLA DPD FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+D
Sbjct:   62 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLAD 261          
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 3.474e-52
Identity = 109/204 (53.43%), Postives = 138/204 (67.65%), Query Frame = 1
Query:  235 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    ++   + A+ A +++L+G  E YRI  G   ++ D L+PGG FDPLGLA DP+ FA LKVKE+KNGRLAMF+M GFF+QA VTG+GP+ENLA HLSD
Sbjct:   52 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSD 251          
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 5.926e-52
Identity = 108/204 (52.94%), Postives = 137/204 (67.16%), Query Frame = 1
Query:  235 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G    I    + A+ A +++L+G  E YR+  G   ++ D ++PGG FDPLGLA DPD FA +KVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+D
Sbjct:   62 WYGPDRVMYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFADVKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLAD 261          
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 5.926e-52
Identity = 109/204 (53.43%), Postives = 137/204 (67.16%), Query Frame = 1
Query:  235 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE F + G   G EAVWFK G+ +     L+Y G    ++   + A+ A ++VL+G  E YR+  G   ++ D L+PGG FDPLGLA DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+D
Sbjct:   50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD 249          
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 7.740e-52
Identity = 108/204 (52.94%), Postives = 138/204 (67.65%), Query Frame = 1
Query:  235 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    ++   + A+ A +++L+G  E YRI  G   ++ D L+PGG FDPLGLA DP+ FA LKVKE+KNGRLAMF+M GFF+QA VTG+GP+ENLA HL+D
Sbjct:   53 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD 252          
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB23_PETSP (Chlorophyll a-b binding protein 22R, chloroplastic OS=Petunia sp. GN=CAB22R PE=3 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.011e-51
Identity = 109/204 (53.43%), Postives = 137/204 (67.16%), Query Frame = 1
Query:  235 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            WYGPDR  +L        E P YLTGE P DYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE F + G   G EAVWFK GA +     L+Y G    ++   + A+ A ++VL+G  E YR+  G   ++ D L+PGG FDPLGLA+DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+D
Sbjct:   51 WYGPDRVKYLGPF---SGEAPSYLTGEFPSDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGIKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD 250          
BLAST of CX671282 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.320e-51
Identity = 109/204 (53.43%), Postives = 137/204 (67.16%), Query Frame = 1
Query:  235 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSD 831
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK G+ +     L+Y G    ++   + A+ A ++VL+G  E YRI  G   ++ D L+PGG FDPLGLA+DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+D
Sbjct:   49 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAD 248          
The following BLAST results are available for this feature:
BLAST of CX671282 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
CB26_ARATH1.252e-11880.00Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB2_DUNTE4.385e-5554.11Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2B_PINSY1.194e-5252.94Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB2A_PINSY1.560e-5253.43Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB28_PEA3.474e-5253.43Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB2A_PYRPY5.926e-5252.94Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB24_PETSP5.926e-5253.43Chlorophyll a-b binding protein 25, chloroplastic ... [more]
CB22_PEA7.740e-5252.94Chlorophyll a-b binding protein AB80, chloroplasti... [more]
CB23_PETSP1.011e-5153.43Chlorophyll a-b binding protein 22R, chloroplastic... [more]
CB2B_SOLLC1.320e-5153.43Chlorophyll a-b binding protein 1B, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10B03_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10B03-C6-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671282 ID=CX671282|Name=CX671282|organism=Citrus sinensis|type=EST|length=832bp
AACACTCTGAAGATGGCTTCATTGGCAGCATCGTCCACTCCTGCTGCCTC
CATTGGAGCTAAGGAGATGCTTGGCAACCCTCTCAATGTCAGCAGTGCTG
TTAGGACTTCAGCTCCAGGTGCATCAAACCCTTCTACTTTCAAGCCCGTT
GCTCTCTTCTCCAAGAAGAAAGCCGCCCCTCCTGCCAAGTCTAAGCCCGT
CGCCGTCTCCCCCGTTAACGAAGAGCTCGCCAAGTGGTATGGTCCTGACC
GAAGAATTTTCTTGCCCGAGGGTCTCTTGGACAGATCTGAGATCCCTGAG
TACTTGACCGGAGAAGTTCCCGGAGACTATGGTTACGATCCTTTTGGTCT
CAGCAAGAAACCAGACGACTTCAGCAAATATCAGGCATATGAATTGATTC
ATGCCAGATGGGCCATGCTTGGTGCTGCTGGTTTCATCATTCCTGAAGCC
TTTAACAAGTTTGGTGCTAACTGTGGTCCTGAAGCTGTCTGGTTCAAGAC
TGGAGCTCTACTTCTTGATGGAAACACATTGAACTACTTCGGAAAGAACA
TCCCAATCAACCTTGTTTTTGCTGTCATTGCTGAGATTGTTCTTGTAGGT
GGTGCTGAATATTATAGAATCACCAACGGTTTGGATTTGGAGGACAAGCT
TCACCCAGGTGGTCCATTTGACCCACTGGGATTAGCAAAGGATCCTGACC
AATTTGCATTGCTAAAAGTGAAGGAGATCAAGAATGGAAGACTTGCAATG
TTTGCCATGCTTGGTTTCTTTCTCCAAGCTTATGTCACAGGTGAAGGTCC
AGTTGAGAACCTTGCTAAACATCTCAGTGATC
back to top