CX671281

Overview
NameCX671281
Unique NameCX671281
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8493 contig Csv1_Contig8493:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 3.586e-119
Identity = 202/225 (89.78%), Postives = 216/225 (96.00%), Query Frame = -3
Query:  127 NEELAKWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVLVGGAEYYRITNGLDLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANNLLTVISGNAERAPTL 801
            ++ELAKWYGPDRRIFLP+GLLDRSEIPEYL GEV GDYGYDPFGL KKP++F+KYQA+ELIHARWAMLGAAGFIIPEA NK+GANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLV AV+AE+VL+GGAEYYRITNGLD EDKLHPGGPFDPLGLAKDP+Q ALLKVKEIKNGRLAMFAMLGFF+QAYVTGEGPVENLAKHLSDPF NNLLTVI+G AERAPTL
Sbjct:   56 SDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAGTAERAPTL 280          
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.530e-56
Identity = 114/211 (54.03%), Postives = 141/211 (66.82%), Query Frame = -3
Query:  175 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPIN---LVFAVIAEIVLVGGAEYYRITNG----LDLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFAN 786
            ++YGPDR  FL  G    ++ PEYLTGE PGDYG+D  GLS  P  F++Y+  ELIHARWA+LGA G + PE  +++      E VWFK GA +     LNY G    I+   ++  +  ++VL+G AE YR   G    LD  D L+PGGPFDPLGLA DPD FA LKVKEIKNGRLAMF+ LGFF+QA VTG+GPV+NL  HL+DP  N
Sbjct:   32 EFYGPDRAKFL--GPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFDPLGLADDPDTFAELKVKEIKNGRLAMFSCLGFFVQAIVTGKGPVQNLTDHLADPTVN 240          
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.813e-54
Identity = 111/209 (53.11%), Postives = 142/209 (67.94%), Query Frame = -3
Query:  172 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 783
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P++F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G    ++   + A+ A +++L+G  E YRI  G   ++ D ++PGG FDPLGLA+DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:   58 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 262          
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.368e-54
Identity = 112/209 (53.59%), Postives = 140/209 (66.99%), Query Frame = -3
Query:  172 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 783
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G    I    + A+ A +++L+G  E YR+  G   ++ D ++PGG FDPLGLA DPD FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:   62 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 266          
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 5.275e-54
Identity = 112/209 (53.59%), Postives = 141/209 (67.46%), Query Frame = -3
Query:  172 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 783
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    ++   + A+ A +++L+G  E YRI  G   ++ D L+PGG FDPLGLA DP+ FA LKVKE+KNGRLAMF+M GFF+QA VTG+GP+ENLA HLSDP  NN
Sbjct:   52 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNN 256          
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 8.997e-54
Identity = 111/209 (53.11%), Postives = 140/209 (66.99%), Query Frame = -3
Query:  172 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 783
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G    I    + A+ A +++L+G  E YR+  G   ++ D ++PGG FDPLGLA DPD FA +KVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:   62 WYGPDRVMYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFADVKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNN 266          
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 8.997e-54
Identity = 112/209 (53.59%), Postives = 140/209 (66.99%), Query Frame = -3
Query:  172 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 783
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE F + G   G EAVWFK G+ +     L+Y G    ++   + A+ A ++VL+G  E YR+  G   ++ D L+PGG FDPLGLA DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:   50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 254          
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 8.997e-54
Identity = 114/209 (54.55%), Postives = 139/209 (66.51%), Query Frame = -3
Query:  172 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITNGLDLE--DKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 783
            WYGPDR  +L        +IP YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE  +K G   G EAVWFK G+ +     L+Y G    I    + A+ A ++VL+G  E YR+  G   E  D ++PGG FDPLGLA DPD FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENL  HL+DP ANN
Sbjct:   49 WYGPDRPKYLGPF---SDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANN 253          
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.175e-53
Identity = 111/209 (53.11%), Postives = 141/209 (67.46%), Query Frame = -3
Query:  172 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 783
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    ++   + A+ A +++L+G  E YRI  G   ++ D L+PGG FDPLGLA DP+ FA LKVKE+KNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:   53 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 257          
BLAST of CX671281 vs. ExPASy Swiss-Prot
Match: CB23_PETSP (Chlorophyll a-b binding protein 22R, chloroplastic OS=Petunia sp. GN=CAB22R PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.535e-53
Identity = 112/209 (53.59%), Postives = 140/209 (66.99%), Query Frame = -3
Query:  172 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL--VFAVIA-EIVLVGGAEYYRITNGL--DLEDKLHPGGPFDPLGLAKDPDQFALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFANN 783
            WYGPDR  +L        E P YLTGE P DYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE F + G   G EAVWFK GA +     L+Y G    ++   + A+ A ++VL+G  E YR+  G   ++ D L+PGG FDPLGLA+DP+ FA LKVKEIKNGRLAMF+M GFF+QA VTG+GP+ENLA HL+DP  NN
Sbjct:   51 WYGPDRVKYLGPF---SGEAPSYLTGEFPSDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGIKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN 255          
The following BLAST results are available for this feature:
BLAST of CX671281 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
CB26_ARATH3.586e-11989.78Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB2_DUNTE2.530e-5654.03Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2B_PINSY1.813e-5453.11Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB2A_PINSY2.368e-5453.59Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB28_PEA5.275e-5453.59Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB2A_PYRPY8.997e-5453.11Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB24_PETSP8.997e-5453.59Chlorophyll a-b binding protein 25, chloroplastic ... [more]
CB21_GOSHI8.997e-5454.55Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB22_PEA1.175e-5353.11Chlorophyll a-b binding protein AB80, chloroplasti... [more]
CB23_PETSP1.535e-5353.59Chlorophyll a-b binding protein 22R, chloroplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10B03_b Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10B03-C6-6.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671281 ID=CX671281|Name=CX671281|organism=Citrus sinensis|type=EST|length=881bp
TTTTTTTTTTTAGGGATTCGAGTGCCATGATCATTTAAGGTTTCAACATC
TTGGAAATGTCTTGATGATGAGATGTACAATGCATTTTAGATTCGAGTGA
AAAGAACACCAGAACAACTGAAATCACAGGGTGGGAGCTCTCTCTGCGTT
TCCGGAGATCACGGTAAGCAAGTTGTTGGCAAAAGGATCACTGAGATGTT
TAGCAAGGTTCTCAACTGGACCTTCACCTGTGACATAAGCTTGGAGAAAG
AAACCAAGCATGGCAAACATTGCAAGTCTTCCATTCTTGATCTCCTTCAC
TTTTAGCAATGCAAATTGGTCAGGATCCTTTGCTAATCCCAGTGGGTCAA
ATGGACCACCTGGGTGAAGCTTGTCCTCCAAATCCAAACCGTTGGTGATT
CTATAATATTCAGCACCACCTACAAGAACAATCTCAGCAATGACAGCAAA
AACAAGGTTGATTGGGATGTTCTTTCCGAAGTAGTTCAATGTGTTTCCAT
CAAGAAGTAGAGCTCCAGTCTTGAACCAGACAGCTTCAGGACCACAGTTA
GCACCAAACTTGTTAAAGGCTTCAGGAATGATGAAACCAGCAGCACCAAG
CATGGCCCATCTGGCATGAATCAATTCATATGCCTGATATTTGCTGAAGT
CGTCTGGTTTCTTGCTGAGACCAAAAGGATCGTAACCATAGTCTCCGGGA
ACTTCTCCGGTCAAGTACTCAGGGATCTCAGATCTGTCCAAGAGACCCTC
GGGCAAGAAAATTCTTCGGTCAGGACCATACCACTTGGCGAGCTCTTCGT
TAACGGGGGAGACGGCGACGGGCTTAGACTTGGCAGGAGGGGCGGCTTTC
TTCTTGGAGAAGAGAGCAACGGGCTTGAAAG
back to top