CX671274

Overview
NameCX671274
Unique NameCX671274
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length840
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4185 contig Csv1_Contig4185:604..1443. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HATB_ARATH (Histone acetyltransferase type B catalytic subunit OS=Arabidopsis thaliana GN=HAG2 PE=2 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 4.359e-103
Identity = 182/279 (65.23%), Postives = 231/279 (82.80%), Query Frame = 1
Query:    4 LYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPLYQRKGYGSFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVE--TSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVS 834
            LYSRL+PLVLL VDGSNPIDVTDP W LY+LI+KK +++ D  +R++GFTAIY+FY YPD  RMRLSQIL+LP +Q KG GS+L EV++NVA+ ENV+D TVEEP + FQH+RTC+DI  L +F+PI+  I+SAV  L +GKLSKK   PRF PP + +E+VR+ LKINKKQFL+CWEILIYL LDP+DKYMEDYT++I+N VR DILGKD  +  K+++DVPSS++PE SFV+FKS N E   + VQ+DEN+P QE+QLKQLV+ERI+EIKL+A+KVS
Sbjct:  182 LYSRLVPLVLLFVDGSNPIDVTDPDWHLYLLIQKKEEKE-DPLYRIVGFTAIYKFYRYPDRLRMRLSQILVLPSFQGKGLGSYLMEVVNNVAITENVYDLTVEEPSEKFQHIRTCIDINRLRSFDPIKPDIDSAVQTLTKGKLSKKAQIPRFTPPLNAIEKVRESLKINKKQFLKCWEILIYLALDPIDKYMEDYTSVITNHVRTDILGKDIETPKKQVVDVPSSFEPEASFVVFKSVNGEEANTNVQVDENKPDQEQQLKQLVEERIREIKLVAEKVS 459          
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HAT1_MAIZE (Histone acetyltransferase type B catalytic subunit OS=Zea mays GN=HAT1 PE=1 SV=2)

HSP 1 Score: 258.455 bits (659), Expect = 3.486e-68
Identity = 132/282 (46.81%), Postives = 197/282 (69.86%), Query Frame = 1
Query:    4 LYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPLYQRKGYGSFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVD-KYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQP----SQEEQLKQLVDERIKEIKLIAQKVS 834
            LYSRL+PLVLLLV+GS PID+ +  WE+ +L+ KK  Q+   +  LLGF A++ FYHYP+S R+R+SQIL+LP YQ +G+G  L E ++ +A +EN++D T+E P D  Q+VR+ +D   LL F+PI+ A+ + V  LK+  LSK+  + R VPPA  +E VR+ LKINKKQFL+CWEIL++L LD  D K M+++   I +R++ +ILG  SG+  KR++ +P+S++ E SF ++ +Q +E    Q  E QP    +QE+QL +LVD +I+EI  +A+ V+
Sbjct:  175 LYSRLVPLVLLLVEGSTPIDIGEHGWEM-LLVVKKATQEAGSKFELLGFAAVHNFYHYPESIRLRISQILVLPPYQGEGHGLGLLEAINYIAQSENIYDVTIESPSDYLQYVRSSIDCLRLLMFDPIKPALGAIVLSLKETNLSKRAQSLRMVPPADLMETVRQKLKINKKQFLRCWEILVFLSLDSQDHKSMDNFRACIYDRMKGEILGSASGTNRKRLLQMPTSFNKEASFAVYWTQEIEDEDEQTVEQQPEDLKTQEQQLNELVDIQIEEIAGVAKNVT 455          
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HAT1_ORYSJ (Probable acetyltransferase type B catalytic subunit OS=Oryza sativa subsp. japonica GN=HATB PE=2 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.951e-67
Identity = 125/282 (44.33%), Postives = 194/282 (68.79%), Query Frame = 1
Query:    4 LYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPLYQRKGYGSFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVD-KYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQP----SQEEQLKQLVDERIKEIKLIAQKVS 834
            LY RL+PL+LLLV+GS PID+T+  WE+ ++++K           +LGF A++ FYHYP+STR+R+SQIL+LP YQ +G+G  L E +++++ +EN++D T+E+P D  Q++R+ +D   LL F+PI+ A+ S VS LK   LSK+  + + VPP+   E VR+ LKINKKQFL+CWEILIYL LD  D K M+++   I +R++ +ILG  +G   KR++ +PS++D E  F ++ +Q+   +  Q  E QP    +QE+QL ++VD +++EI  IA+ V+
Sbjct:  172 LYCRLVPLILLLVEGSTPIDITEHGWEMLLVVKKSAQASSSSNFLVLGFAAVHHFYHYPESTRLRISQILVLPPYQGEGHGLRLLETINSISESENIYDVTIEDPSDYLQYIRSSIDCLRLLTFDPIKPALCSMVSSLKDTNLSKRTSSLKMVPPSDLAETVRQKLKINKKQFLRCWEILIYLNLDAEDRKSMDNFRACIYDRIKGEILGTSTGPNGKRLVQMPSNFDEETCFAVYWTQDGGDADDQTVEQQPEDLKTQEQQLNEVVDSQMEEIVEIAKNVT 453          
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HAT12_DICDI (Histone acetyltransferase type B catalytic subunit DDB_G0275159 OS=Dictyostelium discoideum GN=DDB_G0275159 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.448e-21
Identity = 77/290 (26.55%), Postives = 137/290 (47.24%), Query Frame = 1
Query:    7 YSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPLYQRKGYGSFLTEVL-----SNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRL----DPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQ------------NVETSGVQMDENQPSQEEQLKQLVD-ERIKEI 810
            + +L   VL  +DGS+ I   DP W+++ +  K++   G+ ++ + G++ IY FYH+P+ TR R+SQ LILP YQR G+G +L   +     +N      V+D T+E+P D F  +R  VD+++++                   KL   ++        S  EE+RK L +  KQ   C EI ++ +     +   KY E +   I  R+ +  +G DS   +K    V    +  +     + Q            N++ +    +   PS+ E+ K+ ++ +R++EI
Sbjct:  174 HEKLQIFVLWYIDGSSYIWTDDPNWDIFFIFEKRIID-GEKRYGITGYSTIYNFYHHPEQTRARISQYLILPPYQRMGHGKYLFNSIHQYYKTNDGFYGPVYDVTIEDPADDFNLLRNYVDLKNII-----------------DEKLFDNVILDLNANNKSVFEEIRKKLLVPHKQSKVCLEIYLFSKFLATPNSNPKYKE-FRIAIKKRLYKQNIG-DSEQIEKMKQQVAQENEDNLRLEQEELQELQDIENKKNGTNIKVAINTKELTTPSEPEKSKEEIEKDRLEEI 443          
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HAT11_DICDI (Histone acetyltransferase type B catalytic subunit DDB_G0274269 OS=Dictyostelium discoideum GN=DDB_G0274269 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.448e-21
Identity = 75/289 (25.95%), Postives = 134/289 (46.37%), Query Frame = 1
Query:    7 YSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPLYQRKGYGSFLTEVL-----SNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILI---YLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVET-------SGVQMD------ENQPSQEEQLKQLVDERIKEI 810
            + +L   VL  +DGS+ I   DP W+++ +  K++   G+ ++ + G++ IY FYH+P+ TR R+SQ LILP YQR G+G +L   +     +N      ++D T+E+P D F  +R  VD+++++                   KL   ++        S  EE+RK L I  KQ   C EI +   +L     D   ++Y   I  R+ +  +G DS   +K    V       +     + Q ++        + +++D         P  E+  +++  +R++EI
Sbjct:  194 HEKLQIFVLWYIDGSSYIWTDDPNWDIFFIFEKRIID-GEKRYGITGYSTIYNFYHHPEQTRARISQYLILPPYQRMGHGKYLFNSIYQYYKTNDGFYGPIYDITIEDPADEFNLLRNYVDLKNIM-----------------DEKLFDNVILDLNANNKSVFEEIRKKLLIPYKQSKLCLEIYLFSKFLGTPNSDTKYKEYRISIKKRLYKQNIG-DSEQIEKIKQQVAEENQENLRLEQEELQELQDIENKKNGTNIKVDIKPKELTTPPGPEKNKEEIEKDRLEEI 463          
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HAT1_CANAL (Histone acetyltransferase type B catalytic subunit OS=Candida albicans GN=HAT1 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.390e-16
Identity = 57/195 (29.23%), Postives = 96/195 (49.23%), Query Frame = 1
Query:    4 LYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYP-----DST----RMRLSQILILPLYQRKGYGS-FLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRL 558
            L+ RL  LVLL ++  + ID  D  W LY+L  K      + +  ++GFT  Y ++ YP     DST    R+++SQ +ILP+YQ +G G  F + +       +++ +  VE+P +SF  +R   D++ L   E                +   K + P+       VE+ R+ LK+ K+QF +  EI++  +L
Sbjct:  157 LHQRLQILVLLFIEAGSFIDAKDELWNLYVLYEKDNKSTSNNEPSIVGFTTAYNYWKYPGAKKFDSTEQESRIKISQFIILPIYQGQGLGQLFYSHLFDKWLAQDDIIEVVVEDPNESFDDLRDRADLKRLNTSE----------------QFDFKAVTPKV--DKEWVEKTRRALKLEKRQFARLLEIILLYKL 333          
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HAT1_USTMA (Histone acetyltransferase type B catalytic subunit OS=Ustilago maydis GN=HAT1 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.899e-16
Identity = 60/212 (28.30%), Postives = 104/212 (49.06%), Query Frame = 1
Query:    7 YSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPLYQRKGYGSFL-TEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVD-KYMEDYTTIISNRV---REDIL 627
            + R+    LL ++G++ I   +  WE + L  K         H  +G+T++Y+F+ +PDS+R+RLSQ +ILP +Q++G+G  L T V   +    NV + TVE+P + F  +R   D++ LLA                  K   K+ AP        +E  R   K+  +Q+ +  E++  + LD  D + ++ Y   +  R+    +DIL
Sbjct:  174 HRRMQLFTLLFIEGASYIQEDETNWEFFTLYEKVSRDDKQTWH-FMGYTSLYKFWCWPDSSRIRLSQFVILPPFQKQGHGGALYTTVYDQIRERANVTELTVEDPSEDFDRLRDGNDLRRLLA----------PGGFADSAKAQNKLHAPL---DKEWIESQRLQHKLAPRQWSRVLEMVQLMNLDTTDHEQVKQYRLQVKARIYRQNKDIL 371          
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HAT1_YEAST (Histone acetyltransferase type B catalytic subunit OS=Saccharomyces cerevisiae GN=HAT1 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.537e-15
Identity = 60/200 (30.00%), Postives = 98/200 (49.00%), Query Frame = 1
Query:    4 LYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHY----------PDSTRMRLSQILILPLYQRKGYGSFLTE-VLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHL--LAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDP 564
            ++ R+    LL ++ +N ID TDP W++Y L+ KK  +       L+GF   Y+++HY              R ++SQ LI P YQ KG+GS L E ++ +    +++ + TVE+P ++F  +R   DIQ L  L ++ +           K   LS + L           E  RK LK+ ++QF +  E+L+ L   P
Sbjct:  149 MHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKE-------LIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAV---------FQKHSDLSDEFL-----------ESSRKSLKLEERQFNRLVEMLLLLNNSP 321          
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HAT1_CRYNE (Histone acetyltransferase type B catalytic subunit OS=Cryptococcus neoformans GN=HAT1 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.472e-15
Identity = 53/190 (27.89%), Postives = 100/190 (52.63%), Query Frame = 1
Query:    7 YSRLIPLVLLLVDGSNPIDVTDPRWELYILI-RKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPLYQRKGYGSFLTEVL-SNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVE---EVRKVLKINKKQFLQCWEILIYLRLD 561
            + R+   VLL ++G + +   +  WE  +L  R+     G   +  +G+ ++Y F+ YPD  R+RLSQ +ILP YQ +G+GS L  +L  ++     V + T+E+P ++F+ +R   D++ L+     +  +   + ++  GK  +           S VE    +R+  KI ++QF +  E+L++ +LD
Sbjct:  183 HRRMQIFVLLFIEGGSYVHEDEDAWEFIVLYERRTRPDSGIFTYHFVGYVSVYPFWCYPDRVRLRLSQFVILPPYQHQGHGSKLYNMLFRHMLDRSEVAELTIEDPAEAFEDLRDRNDLRFLVK----EGIVKDPMLYVDVGKGKR----------GSRVEWELAIRRKYKIAQRQFDRLLEMLLFRQLD 358          
BLAST of CX671274 vs. ExPASy Swiss-Prot
Match: HAT1_RAT (Histone acetyltransferase type B catalytic subunit OS=Rattus norvegicus GN=Hat1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.101e-13
Identity = 73/281 (25.98%), Postives = 123/281 (43.77%), Query Frame = 1
Query:    7 YSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRFYHYPDSTRMRLSQILILPLYQRKGYGSFLTEVLSNVAVA-ENVHDFTVEEPLDSFQHVRTCVDI---QHLLAF--EPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVD-KYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQK 828
            + RL   ++  ++ ++ IDV D RW  Y L+ +K ++ G      +G+  +Y +Y YPD TR R+SQ+LIL  +Q +G+G+ L E +    +A  +V D T E+P  S+  +R  V +   Q L  F  E +    N  ++   Q K                        KINK+   + +EIL  L  D  D +    Y   I  R+      K +     R    P     +M+ +    Q+ +             EEQ ++LV++  + I+ +AQ+
Sbjct:  175 HERLQTFLMWFIETASFIDVDDERWH-YFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYIASSSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSRERLLQGFNEDMAIQAQQK-----------------------FKINKQHARRVYEILRLLVTDMSDAEQCRSYRLDIKRRLISPYKKKQTDLAKMRKCLRPEELTNQMNQIEISVQHEQL------------EEQFQELVEDYRRVIERLAQE 419          
The following BLAST results are available for this feature:
BLAST of CX671274 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
HATB_ARATH4.359e-10365.23Histone acetyltransferase type B catalytic subunit... [more]
HAT1_MAIZE3.486e-6846.81Histone acetyltransferase type B catalytic subunit... [more]
HAT1_ORYSJ2.951e-6744.33Probable acetyltransferase type B catalytic subuni... [more]
HAT12_DICDI2.448e-2126.55Histone acetyltransferase type B catalytic subunit... [more]
HAT11_DICDI2.448e-2125.95Histone acetyltransferase type B catalytic subunit... [more]
HAT1_CANAL1.390e-1629.23Histone acetyltransferase type B catalytic subunit... [more]
HAT1_USTMA6.899e-1628.30Histone acetyltransferase type B catalytic subunit... [more]
HAT1_YEAST1.537e-1530.00Histone acetyltransferase type B catalytic subunit... [more]
HAT1_CRYNE4.472e-1527.89Histone acetyltransferase type B catalytic subunit... [more]
HAT1_RAT1.101e-1325.98Histone acetyltransferase type B catalytic subunit... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A09_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A09-A18-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671274 ID=CX671274|Name=CX671274|organism=Citrus sinensis|type=EST|length=840bp
CACCTCTACAGTCGTTTAATACCTCTTGTTCTTCTTCTTGTTGATGGAAG
CAACCCTATTGATGTTACTGATCCAAGATGGGAGTTATATATCCTGATTC
GGAAGAAAATGGATCAGCAAGGAGATATTCAACATAGACTTCTTGGTTTT
ACAGCAATATATCGCTTCTATCATTACCCTGACAGTACACGCATGCGACT
CAGTCAGATTTTGATATTGCCTCTTTACCAGCGCAAGGGCTATGGCAGTT
TCCTTACAGAGGTGCTCAGCAATGTTGCAGTAGCTGAAAATGTCCACGAC
TTCACAGTTGAAGAGCCATTAGATTCCTTCCAACACGTTCGCACTTGTGT
CGACATACAACACCTGCTTGCTTTTGAGCCAATCCAGCATGCAATTAACT
CAGCTGTTTCGCATCTGAAGCAAGGGAAACTATCAAAAAAAATCCTTGCC
CCTCGATTTGTGCCACCTGCCAGTACTGTAGAGGAAGTCAGGAAAGTGTT
GAAAATCAACAAGAAACAGTTTCTCCAATGTTGGGAGATTTTAATATATC
TTCGCCTTGATCCTGTTGACAAGTACATGGAGGATTATACCACAATCATT
TCAAATCGTGTGAGGGAAGATATCTTAGGAAAAGATTCAGGCAGTACTGA
CAAGCGCATAATGGATGTACCTAGCTCTTATGATCCGGAGATGTCTTTTG
TCATGTTCAAGTCACAGAATGTTGAAACTAGTGGTGTCCAAATGGATGAA
AATCAACCGAGTCAAGAAGAGCAGCTGAAGCAGTTGGTTGATGAAAGGAT
CAAAGAGATCAAGTTAATTGCACAAAAGGTGTCTCCATTA
back to top