CX671273

Overview
NameCX671273
Unique NameCX671273
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length903
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4185 contig Csv1_Contig4185:848..1750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671273 vs. ExPASy Swiss-Prot
Match: HATB_ARATH (Histone acetyltransferase type B catalytic subunit OS=Arabidopsis thaliana GN=HAG2 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 4.620e-69
Identity = 126/198 (63.64%), Postives = 163/198 (82.32%), Query Frame = -3
Query:  314 SFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVE--TSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVS 901
            S+L EV++NVA+ ENV+D TVEEP + FQH+RTC+DI  L +F+PI+  I+SAV  L +GKLSKK   PRF PP + +E+VR+ LKINKKQFL+CWEILIYL LDP+DKYMEDYT++I+N VR DILGKD  +  K+++DVPSS++PE SFV+FKS N E   + VQ+DEN+P QE+QLKQLV+ERI+EIKL+A+KVS
Sbjct:  262 SYLMEVVNNVAITENVYDLTVEEPSEKFQHIRTCIDINRLRSFDPIKPDIDSAVQTLTKGKLSKKAQIPRFTPPLNAIEKVRESLKINKKQFLKCWEILIYLALDPIDKYMEDYTSVITNHVRTDILGKDIETPKKQVVDVPSSFEPEASFVVFKSVNGEEANTNVQVDENKPDQEQQLKQLVEERIREIKLVAEKVS 459          
BLAST of CX671273 vs. ExPASy Swiss-Prot
Match: HAT1_MAIZE (Histone acetyltransferase type B catalytic subunit OS=Zea mays GN=HAT1 PE=1 SV=2)

HSP 1 Score: 165.622 bits (418), Expect = 3.450e-40
Identity = 86/199 (43.22%), Postives = 134/199 (67.34%), Query Frame = -3
Query:  314 LTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVD-KYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQP----SQEEQLKQLVDERIKEIKLIAQKVS 895
            L E ++ +A +EN++D T+E P D  Q+VR+ +D   LL F+PI+ A+ + V  LK+  LSK+  + R VPPA  +E VR+ LKINKKQFL+CWEIL++L LD  D K M+++   I +R++ +ILG  SG+  KR++ +P+S++ E SF ++ +Q +E    Q  E QP    +QE+QL +LVD +I+EI  +A+ V+
Sbjct:  257 LLEAINYIAQSENIYDVTIESPSDYLQYVRSSIDCLRLLMFDPIKPALGAIVLSLKETNLSKRAQSLRMVPPADLMETVRQKLKINKKQFLRCWEILVFLSLDSQDHKSMDNFRACIYDRMKGEILGSASGTNRKRLLQMPTSFNKEASFAVYWTQEIEDEDEQTVEQQPEDLKTQEQQLNELVDIQIEEIAGVAKNVT 455          
BLAST of CX671273 vs. ExPASy Swiss-Prot
Match: HAT1_ORYSJ (Probable acetyltransferase type B catalytic subunit OS=Oryza sativa subsp. japonica GN=HATB PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 6.507e-39
Identity = 83/199 (41.71%), Postives = 133/199 (66.83%), Query Frame = -3
Query:  314 LTEVLSNVAVAENVHDFTVEEPLDSFQHVRTCVDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQCWEILIYLRLDPVD-KYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMFKSQNVETSGVQMDENQP----SQEEQLKQLVDERIKEIKLIAQKVS 895
            L E +++++ +EN++D T+E+P D  Q++R+ +D   LL F+PI+ A+ S VS LK   LSK+  + + VPP+   E VR+ LKINKKQFL+CWEILIYL LD  D K M+++   I +R++ +ILG  +G   KR++ +PS++D E  F ++ +Q+   +  Q  E QP    +QE+QL ++VD +++EI  IA+ V+
Sbjct:  255 LLETINSISESENIYDVTIEDPSDYLQYIRSSIDCLRLLTFDPIKPALCSMVSSLKDTNLSKRTSSLKMVPPSDLAETVRQKLKINKKQFLRCWEILIYLNLDAEDRKSMDNFRACIYDRIKGEILGTSTGPNGKRLVQMPSNFDEETCFAVYWTQDGGDADDQTVEQQPEDLKTQEQQLNEVVDSQMEEIVEIAKNVT 453          
The following BLAST results are available for this feature:
BLAST of CX671273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
HATB_ARATH4.620e-6963.64Histone acetyltransferase type B catalytic subunit... [more]
HAT1_MAIZE3.450e-4043.22Histone acetyltransferase type B catalytic subunit... [more]
HAT1_ORYSJ6.507e-3941.71Probable acetyltransferase type B catalytic subuni... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A09_b Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A09-A18-6.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671273 ID=CX671273|Name=CX671273|organism=Citrus sinensis|type=EST|length=903bp
TTTTTTTTTTTCCATAAAAGTCAAGTCTGTTTCAAATATGAAGGGAATTA
CATCATAGTTTCTAAAGCCGGCAGCGAAGTCGATAGGAATATAGGATGGT
TCACTGCACATATGAACTGTGGCAATTGCCAATTTCCTCCAGAAAATTGG
ATGGCAAAAGCTACGGTGATCAAGTTTAATGAAAAGTTGGTAACTACCAC
TAAACATAGGCTACTAGAACTGCAAGTACAGCTTAGTTGTTTACAGACTA
GTCTTGGTTGAGCTCAACCTACACCAGACTTTCAGAAGACAATTTTTTTC
AGACCGGTAATGGAGACACCTTTTGTGCAATTAACTTGATCTCTTTGATC
CTTTCATCAACCAACTGCTTCAGCTGCTCTTCTTGACTCGGTTGATTTTC
ATCCATTTGGACACCACTAGTTTCAACATTCTGTGACTTGAACATGACAA
AAGACATCTCCGGATCATAAGAGCTAGGTACATCCATTATGCGCTTGTCA
GTACTGCCTGAATCTTTTCCTAAGATATCTTCCCTCACACGATTTGAAAT
GATTGTGGTATAATCCTCCATGTACTTGTCAACAGGATCAAGGCGAAGAT
ATATTAAAATCTCCCAACATTGGAGAAACTGTTTCTTGTTGATTTTCAAC
ACTTTCCTGACTTCCTCTACAGTACTGGCAGGTGGCACAAATCGAGGGGC
AAGGATTTTTTTTGATAGTTTCCCTTGCTTCAGATGCGAAACAGCTGAGT
TAATTGCATGCTGGATTGGCTCAAAAGCAAGCAGGTGTTGTATGTCGACA
CAAGTGCGAACGTGTTGGAAGGAATCTAATGGCTCTTCAACTGTGAAGTC
GTGGACATTTTCAGCTACTGCAACATTGCTGAGCACCTCTGTAAGGAAAC
TGC
back to top