CX671265

Overview
NameCX671265
Unique NameCX671265
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length788
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5039 contig Csv1_Contig5039:1..788. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671265 vs. ExPASy Swiss-Prot
Match: S35B3_PONAB (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Pongo abelii GN=SLC35B3 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 6.850e-23
Identity = 61/169 (36.09%), Postives = 96/169 (56.80%), Query Frame = 3
Query:  291 LFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQF-SYGWYFTFIQGFVYLV--LIYLQGFTTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXXADAQTSPNFSMIGVIMIS 788
            + G++L+   K  QF IC +G F  YL+ G  +E +++   F SYGWY T +Q   Y +  LI LQ    K+   P KTY+ ++ + +G+ GL+  SL +LNYP Q++FK  K++PVM+ G FI G  ++Y   +                AD+  +PNF++ GV++IS
Sbjct:   67 VLGMNLSKFNKLTQFFICVAGVFVFYLIYGYLQELIFSVEGFKSYGWYLTLVQFAFYSIFGLIELQPIQDKRRRIPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQG--KRYNVADVSAAICMSLGLIWFTLADSTIAPNFNLTGVVLIS 233          
BLAST of CX671265 vs. ExPASy Swiss-Prot
Match: S35B3_MOUSE (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Mus musculus GN=Slc35b3 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.603e-22
Identity = 61/169 (36.09%), Postives = 96/169 (56.80%), Query Frame = 3
Query:  291 LFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFS-YGWYFTFIQGFVYLV--LIYLQGFTTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXXADAQTSPNFSMIGVIMIS 788
            + G++L+   K  QFLIC +G F  YL+ G  +E +++   F  YGWY T +Q   Y V  LI LQ    ++   P KTY+ ++ + +G+ GL+  SL +LNYP Q++FK  K++PVM+ G FI G  ++Y   +                AD+  +PNF++ GV++IS
Sbjct:   35 VLGVNLSKFSKLTQFLICVAGVFVFYLIYGYLQELIFSVEGFKPYGWYLTLVQFAFYSVFGLIELQLTQDRRRRIPGKTYMLIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQG--KRYNLADVSAAVCMSLGLIWFTLADSTIAPNFNLTGVMLIS 201          
BLAST of CX671265 vs. ExPASy Swiss-Prot
Match: S35B3_HUMAN (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Homo sapiens GN=SLC35B3 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.603e-22
Identity = 61/169 (36.09%), Postives = 96/169 (56.80%), Query Frame = 3
Query:  291 LFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQF-SYGWYFTFIQGFVYLV--LIYLQGFTTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXXADAQTSPNFSMIGVIMIS 788
            + G++L+   K  QF IC +G F  YL+ G  +E +++   F S GWY T +Q   Y +  LI LQ    K+   P KTY+ ++ + +G+ GL+  SL +LNYP Q++FK  K++PVM+ G FI G  ++Y   +                AD+ T+PNF++ GV++IS
Sbjct:   67 VLGMNLSKFNKLTQFFICVAGVFVFYLIYGYLQELIFSVEGFKSCGWYLTLVQFAFYSIFGLIELQLIQDKRRRIPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQG--KRYNVADVSAAICMSLGLIWFTLADSTTAPNFNLTGVVLIS 233          
BLAST of CX671265 vs. ExPASy Swiss-Prot
Match: S35B3_AEDAE (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Aedes aegypti GN=Papst2 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.694e-19
Identity = 58/179 (32.40%), Postives = 98/179 (54.75%), Query Frame = 3
Query:  264 NKNEEQTRSLFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFS-YGWYFTFIQGFVYLVLIYLQ-GFTTKQMMN--PWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXXADAQTSPNFSMIGVIMIS 788
            +++ ++ + LF   LT      +FL+C +G F  YL+ G  +E ++    F  YGW+ T +Q   Y V  Y++    +K++    P KTYV L+ + +G+ GL+  SL +LNYP Q++FK  K++PV++    I G  +K+   ++               AD+Q SPNF+  GV++IS
Sbjct:   32 DEDRKEVKILF-FDLTYYNTTTKFLLCCAGVFVLYLLYGYMQELIFTLDGFKPYGWFLTLVQFAYYTVFGYVERSLESKRVPRCIPMKTYVLLAFLTLGTMGLSNSSLGYLNYPTQVIFKCCKLVPVLIGSILIQG--KKHGPLDFLAAIAMCLGLTLFTLADSQVSPNFNPFGVLLIS 207          
BLAST of CX671265 vs. ExPASy Swiss-Prot
Match: S35B3_ANOGA (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Anopheles gambiae GN=Papst2 PE=3 SV=4)

HSP 1 Score: 94.7449 bits (234), Expect = 6.001e-19
Identity = 57/176 (32.39%), Postives = 89/176 (50.57%), Query Frame = 3
Query:  273 EEQTRSLFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFS-YGWYFTFIQGFVYLVLIYLQGF---TTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXXADAQTSPNFSMIGVIMIS 788
            E + + LF   LT   +  QFL+C  G F  YLV G  +E ++    F  YGWY T +Q   Y    Y++     TT     P +TY  L+ + +G+ GL+  S+ +LNYP Q++FK  K++PV++    I G  +K+   ++               AD+Q  P+F+  GV +IS
Sbjct:   29 EREIKILF-FDLTHYNRTTQFLLCCGGVFALYLVYGYMQELIFTLEGFRPYGWYLTLVQFAYYTAFGYIERSVERTTVPRCIPLRTYALLAFLTLGTMGLSNSSVGYLNYPTQVIFKCCKLIPVLIGSVLIQG--KKHGPMDFFAATAMCLGLILFTLADSQVQPDFNRFGVFLIS 201          
BLAST of CX671265 vs. ExPASy Swiss-Prot
Match: S35B3_DROME (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Drosophila melanogaster GN=Papst2 PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 8.666e-18
Identity = 61/195 (31.28%), Postives = 100/195 (51.28%), Query Frame = 3
Query:  249 RKVKMNKNEEQTRSLFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFS-YGWYFTFIQGFVY----LVLIYLQGFTT----------KQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXXADAQTSPNFSMIGVIMIS 788
            RK   +++  + R L    LT   +  QFL+  +G FF Y++ G  +E ++    F  YGW+ T +Q   Y    LV   L+G+            +    P +TY+ L+A+ +G+ GL+  SL +LNYP Q++FK  K++PV+V    I G  ++Y   ++               AD+Q +PNF+++GV MIS
Sbjct:   35 RKSSTSESPPELRILC-FDLTYYNRTTQFLLSCAGVFFLYILYGYLQELIFTVEGFKPYGWFLTLVQFGYYIGFGLVERRLEGYRISGGSFWNIEPEPRCIPMRTYLILAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQG--KRYGLLDFAAATCMCIGLAWFTLADSQMTPNFNLLGVAMIS 226          
BLAST of CX671265 vs. ExPASy Swiss-Prot
Match: S35B3_CAEBR (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Caenorhabditis briggsae GN=pst-2 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.132e-17
Identity = 55/178 (30.90%), Postives = 89/178 (50.00%), Query Frame = 3
Query:  267 KNEEQTRSLFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFS-YGWYFTFIQGFVYLVLIYLQ---GFTTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXXADAQTSPNFSMIGVIMIS 788
            K++ +   L G ++  +PKW QF++ S   F  YL  G  +E ++       +GW  T IQ  +Y    Y +      TK+M+ PW+ Y  ++   + + GL+  S+ +LNYP Q++FK  K++PV++ G  I G  ++Y   +                AD + SPNF   G IMIS
Sbjct:   20 KDDVEPIHLLGFNIARKPKWLQFVLLSGAIFILYLGYGYMQELIFKLPGMKPFGWTLTLIQFVIYSGCGYAECAVWHNTKRMI-PWRIYGVIAFFTVATMGLSNASVGYLNYPTQVIFKCCKLIPVLIGGILIQG--KRYGWIDISAAILMSLGIIMFTLADNKVSPNFDSRGYIMIS 194          
BLAST of CX671265 vs. ExPASy Swiss-Prot
Match: S35B3_DROPS (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Drosophila pseudoobscura pseudoobscura GN=Papst2 PE=3 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 3.293e-17
Identity = 61/196 (31.12%), Postives = 101/196 (51.53%), Query Frame = 3
Query:  246 TRKVKMNKNEEQTRSLFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFS-YGWYFTFIQGFVY----LVLIYLQGFTT--KQMMN--------PWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXXADAQTSPNFSMIGVIMIS 788
            TRK   ++   + R L    LT   +  QFL+  +G F  Y++ G  +E ++    F  +GW+ T +Q   Y    LV   L+ + +  + + N        P KTY+ L+A+ +G+ GL+  SL +LNYP Q++FK  K++PV+V    I G  ++Y   ++               AD+Q +PNF+++GV MIS
Sbjct:   30 TRKSSSSELPPELRILC-FDLTHYNQTTQFLLSCAGVFILYILYGYLQELIFTVEGFKPFGWFLTLVQFGYYIGFGLVERRLEAYRSGRRSLWNVEPAPRCIPMKTYLVLAALTLGTMGLSNSSLGYLNYPTQVIFKCCKLIPVLVGSILIQG--KRYGPLDFAAASCMCIGLAWFTLADSQMTPNFNLLGVAMIS 222          
BLAST of CX671265 vs. ExPASy Swiss-Prot
Match: S35B3_CAEEL (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Caenorhabditis elegans GN=pst-2 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 9.581e-17
Identity = 53/177 (29.94%), Postives = 87/177 (49.15%), Query Frame = 3
Query:  267 KNEEQTRSLFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFS-YGWYFTFIQGFVYLVLIYLQGF---TTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXXADAQTSPNFSMIGVIMI 785
            K + +   L G ++  +PKW QF++ S   F  Y+  G  +E ++       +GW  T IQ  +Y    Y +      TK+M+ PW+ Y  ++   + + GL+  S+ +LNYP Q++FK  K++PV++ G  I G  ++Y   +                AD + SPNF   G IMI
Sbjct:   20 KEDVEPIHLLGFNIARKPKWLQFVLLSLAIFILYIGYGYMQELIFKLPGMKPFGWTLTLIQFLIYSGCGYTECIIWHNTKRMI-PWRIYGVIAFFTVATMGLSNASVGYLNYPTQVIFKCCKLIPVLIGGILIQG--KRYGWIDIGAAMLMSLGIIMFTLADNKVSPNFDSRGYIMI 193          
The following BLAST results are available for this feature:
BLAST of CX671265 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
S35B3_PONAB6.850e-2336.09Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_MOUSE2.603e-2236.09Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_HUMAN2.603e-2236.09Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_AEDAE2.694e-1932.40Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_ANOGA6.001e-1932.39Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_DROME8.666e-1831.28Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_CAEBR1.132e-1730.90Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_DROPS3.293e-1731.12Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_CAEEL9.581e-1729.94Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A04_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A04-A8-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671265 ID=CX671265|Name=CX671265|organism=Citrus sinensis|type=EST|length=788bp
ATTTTCCCGAAAATGAAAATTCCGAGAATATTTGCATTCGCATAGAAAAT
CACCTCCTCTTAATTATATTTTCTCATTGTCCCTGTAAATTTGCCATGCA
CAAGCTTTTAGTTTTTTTTTTTTTTTTAAAGGAGTTGTTAACGTGACCAA
ACCGATAATCTAAGTTGCATATAATAGCAGTGTTGATCAAGCTCAAAGTT
TCATTTTTTAAAGCTCATGTTCGGAAGAGTGAGTGGTCAGAATAAACAAG
AAAGGTGAAAATGAACAAGAATGAAGAGCAAACTCGGTCTCTGTTTGGGA
TTTCTCTCACAGATAGACCCAAATGGCAACAATTTCTCATTTGCTCTTCT
GGGTTCTTCTTTGGTTATCTCGTCAATGGCGTCTGCGAGGAATATGTATA
CAATAGGCTGCAATTCAGCTATGGTTGGTATTTCACATTTATTCAAGGAT
TTGTGTATCTTGTCCTCATTTATCTTCAAGGCTTCACCACTAAGCAAATG
ATGAATCCATGGAAGACTTATGTGAAGCTCTCTGCAGTTCTAATGGGTTC
TCATGGACTCACAAAAGGCTCTTTGGCTTTTCTTAACTATCCTGCACAGC
TTATGTTCAAATCCACCAAGGTTTTGCCTGTGATGGTCATGGGAGCCTTC
ATACCAGGCCTCAGGCGAAAATACCCAGCTCACGAATATGTATCTGCATT
ACTTTTAGTTGTGGGATTGATCCTTTTTACCTTAGCCGATGCACAAACTT
CCCCCAATTTCAGCATGATTGGCGTTATCATGATTTCT
back to top