CX671264

Overview
NameCX671264
Unique NameCX671264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5039 contig Csv1_Contig5039:592..1408. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B3_DROPS (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Drosophila pseudoobscura pseudoobscura GN=Papst2 PE=3 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 1.565e-25
Identity = 74/217 (34.10%), Postives = 119/217 (54.84%), Query Frame = -3
Query:  165 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQH-LYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPADDKPIKRTATSSFK 812
            Q++FK  K++PV+V    I G  ++Y   ++              LAD+Q +PNF+++GV MISGAL+ D+ +GN+QE     + +    E++F S  +G   L   ML+TG  F  +  C +H L  +G     +++ ++G   VL+L+   GA   A VTTARKAVT+  S+++F+KP T Q+    L++ +GI L +    +K       S FK
Sbjct:  161 QVIFKCCKLIPVLVGSILIQG--KRYGPLDFAAASCMCIGLAWFTLADSQMTPNFNLLGVAMISGALLCDAAIGNVQEKAMKEH-KAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPLQTFGYGFLFSLSGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTVQYLWSGLIVVLGIYLNVYSKKNKLTFADIRSRFK 374          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B3_DROME (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Drosophila melanogaster GN=Papst2 PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 3.855e-24
Identity = 72/208 (34.62%), Postives = 116/208 (55.77%), Query Frame = -3
Query:  198 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQH---LYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPADDK 812
            Q++FK  K++PV+V    I G  ++Y   ++              LAD+Q +PNF+++GV MISGAL+ D+ +GN+QE       +    E++F S  +G   L   ML+TG  F  +  C +H    + YG L   +++ ++G   VL+L+   GA   A VTTARKAVT+  S+++F+KP T Q+    L++ +GI L +    +K
Sbjct:  165 QVIFKCCKLIPVLVGSILIQG--KRYGLLDFAAATCMCIGLAWFTLADSQMTPNFNLLGVAMISGALLCDAAIGNVQEKAMR-EFKAPSSEVVFYSYGLGFVYLFVIMLVTGNFFSGFAFCLEHPVETFGYGFLF--SLSGYLGIQFVLALVRSSGAPIAATVTTARKAVTIAFSFVLFSKPFTLQYLWSGLIVVLGIYLNVYSKRNK 367          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B3_HUMAN (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Homo sapiens GN=SLC35B3 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.262e-23
Identity = 67/200 (33.50%), Postives = 110/200 (55.00%), Query Frame = -3
Query:  216 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQH-LYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKL 812
            Q++FK  K++PVM+ G FI G  ++Y   +               LAD+ T+PNF++ GV++IS AL  D+ +GN+QE    ++   +  EM+  S  +G   ++  +  T  L  A   C+++ +  YG     ++  + G   VL+LI +FGA     VTT RKA+T++LS++ F KP T Q+    LL+ +GI L +
Sbjct:  172 QVIFKCCKLIPVMLGGVFIQG--KRYNVADVSAAICMSLGLIWFTLADSTTAPNFNLTGVVLISLALCADAVIGNVQEKAMKLH-NASNSEMVLYSYSIGFVYILLGLTCTSGLGPAVTFCAKNPVRTYGYAFLFSLTGYFGISFVLALIKIFGALIAVTVTTGRKAMTIVLSFIFFAKPFTFQYVWSGLLVVLGIFLNV 368          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B3_PONAB (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Pongo abelii GN=SLC35B3 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.608e-22
Identity = 66/200 (33.00%), Postives = 109/200 (54.50%), Query Frame = -3
Query:  216 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQH-LYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKL 812
            Q++FK  K++PVM+ G FI G  ++Y   +               LAD+  +PNF++ GV++IS AL  D+ +GN+QE    ++   +  EM+  S  +G   ++  +  T  L  A   C+++ +  YG     ++  + G   VL+LI +FGA     VTT RKA+T++LS++ F KP T Q+    LL+ +GI L +
Sbjct:  172 QVIFKCCKLIPVMLGGVFIQG--KRYNVADVSAAICMSLGLIWFTLADSTIAPNFNLTGVVLISLALCADAVIGNVQEKAMKLH-NASNSEMVLYSYSIGFVYILLGLTCTSGLGPAVTFCAKNPVRTYGYAFLFSLTGYFGISFVLALIKIFGALIAVTVTTGRKAMTIVLSFIFFAKPFTFQYVWSGLLVFLGIFLNV 368          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B3_MOUSE (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Mus musculus GN=Slc35b3 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 6.154e-22
Identity = 68/200 (34.00%), Postives = 109/200 (54.50%), Query Frame = -3
Query:  216 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQH-LYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKL 812
            Q++FK  K++PVM+ G FI G  ++Y   +               LAD+  +PNF++ GV++IS AL  D+ +GN+QE    ++   +  EM+  S  +G   ++  +  T  L  A   CS++ +  YG     ++  + G   VL+LI +FGA     VTT RKA+T++LS+L F KP T Q+    LL+ +GI L +
Sbjct:  140 QVIFKCCKLIPVMLGGVFIQG--KRYNLADVSAAVCMSLGLIWFTLADSTIAPNFNLTGVMLISLALCADAVIGNVQEKAMKLH-NASNSEMVLYSYSIGFVYILLGLSCTSGLGPAVAFCSKNPVGTYGYAFLFSLTGYFGISFVLALIKIFGALLAVTVTTGRKAMTVVLSFLFFAKPFTFQYIWSGLLVVLGIFLNV 336          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B3_AEDAE (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Aedes aegypti GN=Papst2 PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 8.038e-22
Identity = 71/221 (32.13%), Postives = 117/221 (52.94%), Query Frame = -3
Query:  165 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQH-LYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPADDK----PIKRTATSSFK 812
            Q++FK  K++PV++    I G  +K+   ++              LAD+Q SPNF+  GV++IS AL+ D+ +GN+QE     + +    E++  S  +G   L   MLLTG LF     C ++ +  +G     +++ ++G   VL+L+   GA   A VTTARKAVT+ LS++ F+KP T  +    L++ +GI L +     K     + RTA   ++
Sbjct:  146 QVIFKCCKLVPVLIGSILIQG--KKHGPLDFLAAIAMCLGLTLFTLADSQVSPNFNPFGVLLISLALLCDAAIGNVQEKAMREH-KAPNNEVVIYSYGIGFVYLSVIMLLTGNLFSGITFCMKYPVETFGYAFLFSLSGYLGIQIVLTLVRTCGAPLAATVTTARKAVTIALSFVFFSKPFTINYLWSGLIVVLGIYLNVYSKRSKLTFADLNRTAERIYR 363          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B3_ANOGA (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Anopheles gambiae GN=Papst2 PE=3 SV=4)

HSP 1 Score: 100.138 bits (248), Expect = 1.516e-20
Identity = 65/200 (32.50%), Postives = 107/200 (53.50%), Query Frame = -3
Query:  216 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQH-LYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKL 812
            Q++FK  K++PV++    I G  +K+   ++              LAD+Q  P+F+  GV +IS AL+ D+ +GN+QE     +      E++  S  +G   L   MLL+G L +    C+++ +  YG     ++  ++G   VL+L+   GA   A VTTARKAVT+ LS++ F+KP T Q+    L++  GI L +
Sbjct:  140 QVIFKCCKLIPVLIGSVLIQG--KKHGPMDFFAATAMCLGLILFTLADSQVQPDFNRFGVFLISLALLCDAAIGNVQEKAMREH-RAPNNEVVIYSYGIGFVYLAVIMLLSGHLVQGVAFCARYPMETYGYAFLFSLTGYLGIQIVLTLVRTCGAPLAATVTTARKAVTIALSFVFFSKPFTIQYLWSGLIVVFGIYLNV 336          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B3_CAEBR (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Caenorhabditis briggsae GN=pst-2 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.318e-19
Identity = 63/200 (31.50%), Postives = 108/200 (54.00%), Query Frame = -3
Query:  216 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLY-VYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKL 812
            Q++FK  K++PV++ G  I G  ++Y   +               LAD + SPNF   G IMISGAL+ D+ +GN+QE        ++  E++  S  +G   +   ++L+GE+F A     ++ +  +G  +  +   ++G   VL+ I +FGA     VTT RKA+T++LS+L+F+KP T ++     ++ + I L L
Sbjct:  133 QVIFKCCKLIPVLIGGILIQG--KRYGWIDISAAILMSLGIIMFTLADNKVSPNFDSRGYIMISGALLADAVIGNIQEKNMKKYGGSSN-EVVLYSYGIGSVFIFTYVVLSGEIFSAIPFFLENSWKTFGYALIFSFLGYLGVNVVLTHIKVFGALVAVTVTTLRKALTIILSFLLFSKPFTIEYVYAGSVVMLAIYLNL 329          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B3_CAEEL (Adenosine 3'-phospho 5'-phosphosulfate transporter 2 OS=Caenorhabditis elegans GN=pst-2 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.128e-18
Identity = 62/200 (31.00%), Postives = 107/200 (53.50%), Query Frame = -3
Query:  216 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLY-VYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKL 812
            Q++FK  K++PV++ G  I G  ++Y   +               LAD + SPNF   G IMI GAL+ D+ +GN+QE        ++  EM+  S  +G   +   ++L+GE+F A     ++ +  +G  +  +   ++G   VL+ I +FGA     VTT RKA+T++LS+++F+KP T ++     ++ + I L L
Sbjct:  133 QVIFKCCKLIPVLIGGILIQG--KRYGWIDIGAAMLMSLGIIMFTLADNKVSPNFDSRGYIMICGALLADAVIGNIQEKNMKKYGGSSN-EMVLYSYGIGSVFIFAFVVLSGEVFSAIPFFLENSWKTFGYALILSCLGYLGVNVVLTHIKVFGALVAVTVTTLRKALTIILSFMLFSKPFTIEYVYAGSVVMLAIYLNL 329          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B2_MOUSE (Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Mus musculus GN=Slc35b2 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.998e-13
Identity = 51/202 (25.25%), Postives = 99/202 (49.01%), Query Frame = -3
Query:  216 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLA---DAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKL 812
            Q++ K++KV+PVM+MG  +   RR Y   EY              L+   + ++SP  ++ G+++++G +  DSF  N Q+A+F     + QM  +F   +      +  +L  G L +      +H       +  ++ +  GQ+ +   I  FGAA   ++ T R+A+ +LLS L++   +T   G G+ ++   + L++
Sbjct:  212 QVLAKASKVIPVMMMGKLVS--RRSYEHWEYLTAGLISIGVSMFLLSSGPEPRSSPATTLSGLVLLAGYIAFDSFTSNWQDALFAYKMSSVQM--MFGVNLFSCLFTVGSLLEQGALLEGARFMGRHSEFALHALLLSICSAFGQLFIFYTIGQFGAAVFTIIMTLRQAIAILLSCLLYGHTVTVVGGLGVAVVFTALLLRV 409          
The following BLAST results are available for this feature:
BLAST of CX671264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
S35B3_DROPS1.565e-2534.10Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_DROME3.855e-2434.62Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_HUMAN4.262e-2333.50Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_PONAB3.608e-2233.00Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_MOUSE6.154e-2234.00Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_AEDAE8.038e-2232.13Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_ANOGA1.516e-2032.50Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_CAEBR8.318e-1931.50Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B3_CAEEL4.128e-1831.00Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B2_MOUSE3.998e-1325.25Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A04_b Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A04-A8-6.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671264 ID=CX671264|Name=CX671264|organism=Citrus sinensis|type=EST|length=817bp
TTTTTTTTTTTTTTTTACTAGTAATTATTTCTTCTGTTTGCTGGTGAAAC
AAGAAACAAAGAAATACATTGTTCATTAGAAAAATTTCTTAAAATTTAGA
CCGGTGCTCTTTTTTCTTCATCTGCTTCTTCACGTTCACTAAAAGATAGT
TTCCGAATGTTGACTTTGAAAGATGATGTTGCAGTTCTCTTGATGGGTTT
GTCATCTGCAGGCAAGAGTTTCAATGTGATGCCCATTGCTATTAGCAGAA
GTCCAGTCCCATGCTGTTCAGTTAATGGCTTTGTGAATATCAAGTATGAC
AATAGTAATGTTACTGCCTTTCTTGCCGTTGTCACCATAGCTGTTGTAGC
AGCACCAAACAGGGCAATGAGGGAAAGGACTGAAACTTGGCCGATAAAGG
TGGCCATGGCTTCAAAGACCAGCACACCGTAAACGTATAGATGCTGAGAG
CAAGAATTCCATGCTTTAAATAACTCCCCTGTCAAAAGCATTGGAGGAAT
CAACATTGGCAAACCGACCACGGTCGAGCAAAACAGCATCTCCATCTGGG
TGGTTTCAGGGTTCATGGTAAAGATGGCTTCTTGCAAATTTCCAAGAAAA
GAATCCATTATTAGAGCACCAGAAATCATGATAACGCCAATCATGCTGAA
ATTTGGGGAAGTTTGTGCATCGGCTAAGGTAAAAAGGATCAATCCCACAA
CTAAAAGTAATGCAGATACATATTCGTGAGCTGGGTATTTTCGCCTGAGG
CCTGGTATGAAGGCTCCCATGACCATCACAGGCAAAACCTTGGTGGATTT
GAACATAAGCTGTGCAG
back to top