CX671262

Overview
NameCX671262
Unique NameCX671262
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length842
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10980 contig Csv1_Contig10980:124..965. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS235_ARATH (23.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.5 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.130e-41
Identity = 105/214 (49.07%), Postives = 132/214 (61.68%), Query Frame = -2
Query:  149 ASSLALKRLVSFNLI--PRAXRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTRSLSQVLNFMDQMTESPFFSGTRG----GLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXESV--RRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVKVD 766
            +S+LAL+RL+S + +  PRA R  V P A S SR FNTNA R Y                                    TRSLSQ+LNFMDQ++E P  S TRG    G+RRGW+ KE DDAL+L IDMPGL +EDV+++LEQNTLVIR           S   RR+TSRI+LPEK+Y+TD+IKAEMKNGVLKV +P +KE+ER ++  + VD
Sbjct:    4 SSALALRRLLSSSTVAVPRALRA-VRPVAAS-SRLFNTNAARNYEDGVDRNHHSNRHVSRHGGDFFSHILDPFTP-----TRSLSQMLNFMDQVSEIPLVSATRGMGASGVRRGWNVKEKDDALHLRIDMPGLSREDVKLALEQNTLVIRGEGETEEGEDVSGDGRRFTSRIELPEKVYKTDEIKAEMKNGVLKVVIPKIKEDERNNIRHINVD 210          
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS22M_PEA (Heat shock 22 kDa protein, mitochondrial OS=Pisum sativum GN=HSP22 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.633e-41
Identity = 106/209 (50.72%), Postives = 129/209 (61.72%), Query Frame = -2
Query:  149 MASSLALKRLVSFNLIPRAXRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTRSLSQVLNFMDQMTESPFFSGTRGGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXE--SVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVKVD 769
            MASSLALKR +S  L+  +    + P A+SASR FNTNA+RQY                                   P RSLSQVLN +D +T++P  S      RRGWDA+ET+DAL L +DMPGLGKEDV++S+EQNTL I+          +  S RR++SRIDLPEKLY+ D IKAEMKNGVLKVTVP +KEEER +V  VKVD
Sbjct:    1 MASSLALKRFLSSGLLSSSF---LRPVASSASRSFNTNAMRQYDQHSDDRNVDVYRHSFPRTRRDDLLLSDVFDPFSPP-RSLSQVLNMVDLLTDNPVLSAAS---RRGWDARETEDALFLRLDMPGLGKEDVKISVEQNTLTIKGEEGAKESEEKEKSGRRFSSRIDLPEKLYKIDVIKAEMKNGVLKVTVPKMKEEERNNVINVKVD 202          
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS23M_ARATH (23.6 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.6 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.803e-40
Identity = 103/215 (47.91%), Postives = 130/215 (60.47%), Query Frame = -2
Query:  149 MASSLALKRLVSFNLIPRAXRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTRSLSQVLNFMDQMTESPFFSGTRG----GLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXESV----RRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVKVD 769
            MAS+LALKRL+S ++ PR+ R  + P+ +S  R FNTNAVR Y                                    TRS+SQVLN MDQ  E+P  S TRG    G RRGWD KE DDAL L IDMPGL +EDV+++LEQ+TLVIR          E      RR+TSRI LP+K+Y+ D+IKAEMKNGVLKV +P +KE+ER DV Q++++
Sbjct:    1 MASALALKRLLSSSIAPRS-RSVLRPAVSS--RLFNTNAVRSYDDDGENGDGVDLYRRSVPRRRGDFFSDVFDPFSP--TRSVSQVLNLMDQFMENPLLSATRGMGASGARRGWDIKEKDDALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGESGNRRFTSRIGLPDKIYKIDEIKAEMKNGVLKVVIPKMKEQERNDVRQIEIN 210          
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS22M_SOYBN (Heat shock 22 kDa protein, mitochondrial OS=Glycine max GN=HSP23.9 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 7.036e-39
Identity = 67/100 (67.00%), Postives = 81/100 (81.00%), Query Frame = -2
Query:  149 RGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXESVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVKVD 448
            RGWDA+ET+DAL+L +DMPGL KEDV++S+EQNTL+I+          ES RRYTSRIDLP+KLY+ DQI+AEMKNGVLKV VP +KEEER DV  VKV+
Sbjct:  112 RGWDARETEDALHLRVDMPGLAKEDVKISVEQNTLIIKGEGAKEGDEEESARRYTSRIDLPDKLYKIDQIRAEMKNGVLKVVVPKMKEEERKDVISVKVE 211          

HSP 2 Score: 37.7354 bits (86), Expect = 7.036e-39
Identity = 20/43 (46.51%), Postives = 31/43 (72.09%), Query Frame = -2
Query:  641 MASSLALKRLVSFNLIPRAXRCTVAPSATSASRFFNTNAVRQY 769
            MASSL  KR +S +L+ R+    + P+A+++ R F+TNA+RQY
Sbjct:    1 MASSLIAKRFLSSSLLSRSL---LRPAASASHRSFDTNAMRQY 40          

HSP 3 Score: 25.7942 bits (55), Expect = 7.036e-39
Identity = 12/24 (50.00%), Postives = 15/24 (62.50%), Query Frame = -1
Query:  483 CV*SIFTNKEPEPGPELHGSDDGE 554
            CV SIF++ E EPG E  G   G+
Sbjct:   72 CVGSIFSDSEFEPGSEHDGPGHGQ 95          
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS23C_CHERU (Small heat shock protein, chloroplastic OS=Chenopodium rubrum GN=HSP23 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.063e-36
Identity = 91/208 (43.75%), Postives = 117/208 (56.25%), Query Frame = -2
Query:  149 SSLALKRLVSFNLIPRAXRCTVAPSATSASRFFNTNAVRQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTRSLSQVLNFMDQMTESPFFSGTRGG---LRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXESVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVKVD 763
            +S+AL+RL S NL+       +     S SR FNTNA                                        TRS+ Q++N MDQ+ E+PF + +RG    +RRGWD +E ++AL L +DMPGL KEDV+VS+E NTL+I+          E  RRY+SRI+L   LY+ D IKAEMKNGVLKVTVP +KEEE+ DVFQV VD
Sbjct:    2 ASMALRRLASRNLVSGGIFRPL-----SVSRSFNTNAQMGRVDHDHELDDRSNRAPISRRGDFPASFFSDVFDPFRATRSVGQLMNLMDQLMENPFMAASRGSGRAMRRGWDVREDEEALELKVDMPGLAKEDVKVSVEDNTLIIKSEAEKETEEEEQRRRYSSRIELTPNLYKIDGIKAEMKNGVLKVTVPKIKEEEKKDVFQVMVD 204          
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS24M_ORYSJ (24.1 kDa heat shock protein, mitochondrial OS=Oryza sativa subsp. japonica GN=HSP24.1 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.899e-27
Identity = 68/129 (52.71%), Postives = 89/129 (68.99%), Query Frame = -2
Query:  149 RSLSQVLNFMDQMTESPFFSGTRGGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXESVR--RYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVKVD 529
            +SL ++L+ MD +  +P        LRRGW+AKE+++AL+L +DMPGLGKE V+V  EQN+LVI+          E     RY+ RI+L  ++YR DQIKAEMKNGVLKV VP VKEE+R DVFQV V+
Sbjct:   93 QSLGRLLSLMDDLA-TPAGRAGAATLRRGWNAKESEEALHLRVDMPGLGKEHVKVWAEQNSLVIKGEGEKEAGEDEGAAPARYSGRIELAPEVYRMDQIKAEMKNGVLKVVVPKVKEEQRRDVFQVNVE 220          
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS26M_ORYSJ (26.2 kDa heat shock protein, mitochondrial OS=Oryza sativa subsp. japonica GN=HSP26.2 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.695e-22
Identity = 66/135 (48.89%), Postives = 82/135 (60.74%), Query Frame = -2
Query:  149 SLSQVLNFM-DQMTESPFFSGTRG----GLRRG--WDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVIRXXXXXXXXXXESVR--RYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVKVD 526
            SL ++L  M D    +    GT G      RRG  W AKE DDA++L + MPGLGKE V+V  EQN+LVI+                RYT RI+LP   ++ D+IKAEMKNGVL+V VP +KEEER DVFQV V+
Sbjct:  114 SLGRLLALMEDAAVATAAAPGTNGLATAAARRGGWWVAKEDDDAVHLKVSMPGLGKEHVKVWAEQNSLVIKGEGEKDPEDDADAAPPRYTRRIELPADAFKMDKIKAEMKNGVLRVAVPKLKEEERKDVFQVNVE 248          
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS25P_ARATH (25.3 kDa heat shock protein, chloroplastic OS=Arabidopsis thaliana GN=HSP25.3 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.283e-16
Identity = 52/136 (38.24%), Postives = 76/136 (55.88%), Query Frame = -2
Query:  155 RSLSQVLNFMDQMTES--PFFSGTRGG-----LRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI----RXXXXXXXXXXESVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVK 529
            R++ Q+L+ MD+M E   P     RGG     +R  WD KE +  + +  DMPGL KEDV++S+E N LVI    +           SV  Y +R+ LP+   + D+IKAE+KNGVL +T+P  K E +    Q++
Sbjct:   93 RTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEK-DKIKAELKNGVLFITIPKTKVERKVIDVQIQ 227          
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS22C_SOYBN (Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.457e-14
Identity = 51/136 (37.50%), Postives = 76/136 (55.88%), Query Frame = -2
Query:  155 RSLSQVLNFMDQMTESPF-FSGTR---GGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI----RXXXXXXXXXXESVRRYTS---RIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVK 529
            RS+ Q+L+ MD++ E    F G     G +R  WD K+ +  + +  DMPGL KEDV+VS+E + LVI    +           S R Y+S   R+ LP+   + D++KAE+KNGVL +T+P  K E +    QV+
Sbjct:   47 RSMRQILDTMDRVFEDTMTFPGRNIGGGEIRAPWDIKDEEHEIRMRFDMPGLAKEDVKVSVEDDMLVIKGGHKSEQEHGGDDSWSSRTYSSYDTRLKLPDNCEK-DKVKAELKNGVLYITIPKTKVERKVIDVQVQ 181          
BLAST of CX671262 vs. ExPASy Swiss-Prot
Match: HS22C_PETHY (Small heat shock protein, chloroplastic OS=Petunia hybrida GN=HSP22 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.457e-14
Identity = 44/135 (32.59%), Postives = 79/135 (58.52%), Query Frame = -2
Query:  155 RSLSQVLNFMDQMTESPF-FSGTR----GGLRRGWDAKETDDALNLSIDMPGLGKEDVRVSLEQNTLVI-----RXXXXXXXXXXESVRRYTSRIDLPEKLYRTDQIKAEMKNGVLKVTVP*VKEEERADVFQVK 529
            R++ Q+++ MD++ E    F G+R    G +R  WD K+ ++ + +  DMPGL KE+V+VS+E + LVI     +           +   Y +R+ LP+ + + D++KAE+KNGVL +++P  K E++    ++K
Sbjct:  108 RTMRQMMDTMDRLFEDTMTFPGSRNRGTGEIRAPWDIKDDENEIKMRFDMPGLSKEEVKVSVEDDVLVIKGEHKKEESGKDDSWGRNYSSYDTRLSLPDNVDK-DKVKAELKNGVLLISIPKTKVEKKVTDVEIK 241          
The following BLAST results are available for this feature:
BLAST of CX671262 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
HS235_ARATH2.130e-4149.0723.5 kDa heat shock protein, mitochondrial OS=Arab... [more]
HS22M_PEA3.633e-4150.72Heat shock 22 kDa protein, mitochondrial OS=Pisum ... [more]
HS23M_ARATH1.803e-4047.9123.6 kDa heat shock protein, mitochondrial OS=Arab... [more]
HS22M_SOYBN7.036e-3967.00Heat shock 22 kDa protein, mitochondrial OS=Glycin... [more]
HS23C_CHERU2.063e-3643.75Small heat shock protein, chloroplastic OS=Chenopo... [more]
HS24M_ORYSJ3.899e-2752.7124.1 kDa heat shock protein, mitochondrial OS=Oryz... [more]
HS26M_ORYSJ1.695e-2248.8926.2 kDa heat shock protein, mitochondrial OS=Oryz... [more]
HS25P_ARATH5.283e-1638.2425.3 kDa heat shock protein, chloroplastic OS=Arab... [more]
HS22C_SOYBN6.457e-1437.50Small heat shock protein, chloroplastic (Fragment)... [more]
HS22C_PETHY6.457e-1432.59Small heat shock protein, chloroplastic OS=Petunia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A03_b Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A03-A6-6.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671262 ID=CX671262|Name=CX671262|organism=Citrus sinensis|type=EST|length=842bp
TTTTTTTATGCGAAGTAACACAATTATTCAAACTTCGAACACCACCATTT
CAGAACATGTTTGTAACTGTTAGCTCACATAAACTACACAAAATTATTCT
CACTCAATATCCTGGACAGAAAAGCTACTACTAAAAGCCAACTCTTTAAT
CAACCTTCACTTGGAACACATCAGCCCTCTCCTCTTCCTTCACCTAGGGC
ACCGTCACCTTCAGCACACCATTCTTCATCTCTGCCTTGATCTGATCAGT
CCTGTAGAGCTTCTCTGGCAAATCAATCCTGCTGGTGTACCTACGCACGC
TCTCTTCGCCCTCTCCTTCTTTTCCGCCCTCGCCTCTGATCACCAGAGTG
TTCTGCTCCAGAGAGACTCTCACGTCTTCCTTGCCCAGCCCTGGCATGTC
GATGCTGAGGTTCAATGCGTCATCGGTTTCTTTAGCATCCCAGCCTCGGC
GCAGTCCACCACGCGTGCCACTGAAGAAAGGGCTCTCCGTCATCTGATCC
ATGAAGTTCAGGACCTGGCTCAGGCTCCTTGTTGGTGAAAATGGATCAAA
CACATCTGAGAAGAAGTCGTCACGACGGCGAGGGAAAGAGCGAGCGGAAC
GGCGATCAATGTCGAGATCACGGTCGTCTCCGCCGTCATCGTATTGACGA
ACAGCGTTTGTGTTGAAGAACCGAGATGCCGAAGTAGCAGAAGGAGCGAC
GGTGCAGCGTANAGCCCTGGGGATGAGATTAAAAGAAACAAGCCTCTTGA
GAGCAAGAGAGGACGCCATTGAGCCGAATTCTTAAAGAAAGCACAAAACA
ATGCAGAGATTTCAAAATACTTTTTGTGACTGCGGCTGATTT
back to top