CX671261

Overview
NameCX671261
Unique NameCX671261
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length768
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX671261_ssr30 microsatellite CX671261_ssr30:30..41. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: ABI5_ARATH (Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis thaliana GN=ABI5 PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.172e-41
Identity = 99/161 (61.49%), Postives = 114/161 (70.81%), Query Frame = -1
Query:  283 PPPPLAVCYXXXXXXXXXXXXXGQPVAAMSPVSSEAVGTDQQVDGSASHQFGMDHMGGIR-KKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKKQQYFEELKMKPYTKAQKAKEKLRIMRRNLSCSL 762
            PP    VCY             G  V  +SPVSS+ +G  Q VD     Q+G+D MGG+R +KR++DGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENA LK ALAE+ERK+KQQYFE LK +   K  K+  +LR + RN SC L
Sbjct:  286 PPVQAGVCYGGGVGFGAGGQQMGM-VGPLSPVSSDGLGHGQ-VDNIGG-QYGVD-MGGLRGRKRVVDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELERKRKQQYFESLKSRAQPKLPKSNGRLRTLMRNPSCPL 442          
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: AI5L1_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 1 OS=Arabidopsis thaliana GN=DPBF2 PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 8.679e-23
Identity = 60/97 (61.86%), Postives = 74/97 (76.29%), Query Frame = -1
Query:  292 KKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKKQQYFEELKMKPYTKAQKAKEKLRIMRRNLS 582
            KKRIIDGP E ++ERRQRRMIKNRESAARSRAR+QAYTVELE ELN L EEN  LK+ + E E+K++Q+     + K  TK +K+ +KLR +RR  S
Sbjct:  235 KKRIIDGPPEILMERRQRRMIKNRESAARSRARRQAYTVELELELNNLTEENTKLKEIVEENEKKRRQEIIS--RSKQVTK-EKSGDKLRKIRRMAS 328          
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: AI5L5_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 5 OS=Arabidopsis thaliana GN=ABF2 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 5.265e-20
Identity = 60/105 (57.14%), Postives = 75/105 (71.43%), Query Frame = -1
Query:  376 VAAMSPVSSEAVGTDQQVDGSASHQFGMDHMGGIRKKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAE-MERKKKQQ 687
            V+ ++P+SSE +G       S S    M + GG+R ++   G VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAE+ +LKEEN  L++  A  ME +K Q+
Sbjct:  292 VSPVTPLSSEGIGKSNGDSSSLSPSPYMFN-GGVRGRK--SGTVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEENDELQRKQARIMEMQKNQE 393          
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: TRAB1_ORYSJ (bZIP transcription factor TRAB1 OS=Oryza sativa subsp. japonica GN=TRAB1 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.098e-17
Identity = 53/102 (51.96%), Postives = 70/102 (68.63%), Query Frame = -1
Query:  292 GIRKKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKKQQYFEELKMKPYTKA--QKAKEKLRIMRRNLS 591
            G+ + R   G VEKVVERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LKE+N  L++   E+   +K  +F E++     +A      +K R +RR L+
Sbjct:  215 GVIRGRRSGGNVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNMELQKKQEEIMEMQK-NFFPEMQKNQVLEAVNNPYGQKKRCLRRTLT 315          
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: AI5L6_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 6 OS=Arabidopsis thaliana GN=ABF3 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.194e-17
Identity = 58/112 (51.79%), Postives = 73/112 (65.18%), Query Frame = -1
Query:  358 VAAMSPVS--SEAVGTDQQVDGSASHQFGMDHMGGIRKKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKKQQYFEELK 687
            VAA+SP S  S  +     +D S S    M   G +RK   +   +EKV+ERRQ+RMIKNRESAARSRARKQAYT+ELEAE+ QLKE N  L++   E+  K+K Q  E L+
Sbjct:  328 VAAVSPGSQMSPDLTPKSALDASLSPVPYM--FGRVRKTGAV---LEKVIERRQKRMIKNRESAARSRARKQAYTMELEAEIAQLKELNEELQKKQVEIMEKQKNQLLEPLR 434          
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: AI5L7_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 7 OS=Arabidopsis thaliana GN=ABF4 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 7.868e-16
Identity = 46/81 (56.79%), Postives = 58/81 (71.60%), Query Frame = -1
Query:  316 VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKKQQYFEELKMKPYTKAQKAKEKL 558
            +EKV+ERRQRRMIKNRESAARSRARKQAYT+ELEAE+ +LK+ N  L++  AEM   +K +  E  K    +K Q  +  L
Sbjct:  347 LEKVIERRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKTNQELQKKQAEMVEMQKNELKETSKRPWGSKRQCLRRTL 427          
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: AI5L4_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 4 OS=Arabidopsis thaliana GN=ABF1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.938e-14
Identity = 45/89 (50.56%), Postives = 60/89 (67.42%), Query Frame = -1
Query:  292 VEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKKQQYFEELKMKPYTKAQKAKEKLRIMRRNLS 558
            +EKVVERRQ+RMIKNRESAARSRARKQAYT+ELEAE+  LK  N  L++  AE+ +    +      +K ++K      K + +RR L+
Sbjct:  307 LEKVVERRQKRMIKNRESAARSRARKQAYTLELEAEIESLKLVNQDLQKKQAEIMKTHNSE------LKEFSKQPPLLAKRQCLRRTLT 389          
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: AI5L3_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 3 OS=Arabidopsis thaliana GN=DPBF4 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.256e-13
Identity = 41/64 (64.06%), Postives = 53/64 (82.81%), Query Frame = -1
Query:  391 KKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMER 582
            +KR+    VEK VERRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN  L++ L E+E+
Sbjct:  178 RKRVAGEIVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENEKLRR-LKEVEK 240          
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: AI5L2_ARATH (ABSCISIC ACID-INSENSITIVE 5-like protein 2 OS=Arabidopsis thaliana GN=DPBF3 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.641e-13
Identity = 51/102 (50.00%), Postives = 64/102 (62.75%), Query Frame = -1
Query:  313 MGGIR------KKRIIDGPV-EKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKKQQYFEELKMKPYTKAQKAKEKLR 597
            MGG+       +KR+  G V EK VERRQ+RMIKNRESAARSRARKQAYT ELE ++++L+EEN          ER +KQ+  E  K+ P       K +LR
Sbjct:  201 MGGLSDTQTPGRKRVASGEVVEKTVERRQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEEN----------ERLRKQKEVE--KILPSVPPPDPKRQLR 290          
BLAST of CX671261 vs. ExPASy Swiss-Prot
Match: GBF4_ARATH (G-box-binding factor 4 OS=Arabidopsis thaliana GN=GBF4 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.835e-11
Identity = 42/93 (45.16%), Postives = 58/93 (62.37%), Query Frame = -1
Query:  373 QQVDGSASHQFGMDHMGGI---RKKRIIDGPVEKVVERRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAHLKQALAEMERKKKQQY 642
            Q V+GS          GG+   ++ R++   ++K   +RQ+RMIKNRESAARSR RKQAY VELE    +L+EEN   +Q L E+E   K++Y
Sbjct:  160 QMVEGSMG--------GGVTRGKRGRVMMEAMDKAAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEEN---EQLLKEIEESTKERY 241          
The following BLAST results are available for this feature:
BLAST of CX671261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
ABI5_ARATH3.172e-4161.49Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis... [more]
AI5L1_ARATH8.679e-2361.86ABSCISIC ACID-INSENSITIVE 5-like protein 1 OS=Arab... [more]
AI5L5_ARATH5.265e-2057.14ABSCISIC ACID-INSENSITIVE 5-like protein 5 OS=Arab... [more]
TRAB1_ORYSJ1.098e-1751.96bZIP transcription factor TRAB1 OS=Oryza sativa su... [more]
AI5L6_ARATH3.194e-1751.79ABSCISIC ACID-INSENSITIVE 5-like protein 6 OS=Arab... [more]
AI5L7_ARATH7.868e-1656.79ABSCISIC ACID-INSENSITIVE 5-like protein 7 OS=Arab... [more]
AI5L4_ARATH1.938e-1450.56ABSCISIC ACID-INSENSITIVE 5-like protein 4 OS=Arab... [more]
AI5L3_ARATH1.256e-1364.06ABSCISIC ACID-INSENSITIVE 5-like protein 3 OS=Arab... [more]
AI5L2_ARATH1.641e-1350.00ABSCISIC ACID-INSENSITIVE 5-like protein 2 OS=Arab... [more]
GBF4_ARATH5.835e-1145.16G-box-binding factor 4 OS=Arabidopsis thaliana GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A02_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A02-A4-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671261 ID=CX671261|Name=CX671261|organism=Citrus sinensis|type=EST|length=768bp
TTTTTTTTTTTTTTTTTATAAGACATGTGTAATTAATTAATACCAAACAC
ATATATATAATTTATACATTGGATTATTTGAGTTCGTAGCCATATCAAAT
TTCTTCAAGACGGCAACTTAAAAACTTTTTCTAATCCTCACAATTCAAAG
CAAATGAGAAAGAAGTACGACAAAAGAACTATTATTACTCGCCCTCCCTT
TTTCTTTAGCTTTTAACAGAATCGGATTCAGATCTTCCTCACGAATGCTT
GGATATGCGCTAGGTTATATATCTTTGCTTTACAATGAGCAACTTAAATT
TCTTCTCATTATTCTCAATTTCTCCTTAGCTTTCTGGGCCTTCGTGTAGG
GTTTCATTTTTAATTCCTCAAAATACTGCTGCTTCTTCTTTCTCTCCATC
TCGGCCAGAGCTTGCTTAAGGTGAGCGTTCTCTTCTTTAAGTTGGTTCAG
TTCGGCTTCCAACTCAACTGTGTATGCCTGCTTTCTAGCTCTAGACCTTG
CAGCAGACTCTCTGTTCTTGATCATCCTCCGCTGCCGCCTCTCTACAACC
TTCTCCACTGGCCCATCAATTATCCTCTTCTTTCTAATCCCGCCCATGTG
ATCCATCCCAAACTGATGACTCGCCGAACCATCAACCTGCTGGTCAGTAC
CCACGGCCTCGGACGACACCGGACTCATCGCTGCCACCGGCTGTCCTCCA
GACGCATATCCACCTCCAGTCCCCACCCTCCCACCATAACAAACAGCCAG
AGGTGGTGGCGGCGGCGG
back to top