CX043359

Overview
NameCX043359
Unique NameCX043359
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length648
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: MTDH_MESCR (Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.515e-48
Identity = 93/120 (77.50%), Postives = 106/120 (88.33%), Query Frame = -1
Query:  289 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTLAA 648
            ++Q AMGTLDGIIDTVSA HP+LPLLGLLKSQGK+++VG PDKPLELPV  L+ GRK ++GS  GGMKETQEMIDFAAKH+I +DIEV+ MDYVNTAMERL K DVRYRFVID+ANTL A
Sbjct:  241 QMQSAMGTLDGIIDTVSAAHPLLPLLGLLKSQGKMIMVGVPDKPLELPVFPLLQGRKILAGSCIGGMKETQEMIDFAAKHDIKSDIEVVPMDYVNTAMERLLKGDVRYRFVIDVANTLKA 360          
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: MTDH_FRAAN (Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 4.408e-48
Identity = 93/118 (78.81%), Postives = 106/118 (89.83%), Query Frame = -1
Query:  295 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTL 648
            ++Q A+GT+DGIIDTVSA HP+LPL+GLL S GKLV+VGAP+KPLELPV  L+MGRK V+GS  GGMKETQEMIDFAA+HNITADIEVI +DY+NTAMERL KADVRYRFVIDI NTL
Sbjct:  238 QMQAAIGTMDGIIDTVSAQHPLLPLIGLLNSHGKLVMVGAPEKPLELPVFPLLMGRKMVAGSGIGGMKETQEMIDFAARHNITADIEVIPIDYLNTAMERLVKADVRYRFVIDIGNTL 355          
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: MTDH_PETCR (Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.086e-46
Identity = 88/118 (74.58%), Postives = 107/118 (90.68%), Query Frame = -1
Query:  295 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTL 648
            ++Q A GTL GIIDTVSA+HP++PLLGLLK  GKLV+VGAP+KPLELPV  L+MGRK ++GS+ GG+KETQEM+DFAA+HNITAD+EVI +DYVNTAMERL K+DVRYRFVID+ANT+
Sbjct:  217 QMQAATGTLHGIIDTVSALHPVVPLLGLLKVNGKLVMVGAPEKPLELPVFPLLMGRKVLAGSNIGGLKETQEMLDFAAQHNITADVEVIPVDYVNTAMERLVKSDVRYRFVIDVANTI 334          
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: CADH7_ARATH (Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis thaliana GN=CAD7 PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 1.086e-46
Identity = 91/121 (75.21%), Postives = 106/121 (87.60%), Query Frame = -1
Query:  286 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTLAAT 648
            +++ AMGT+DGIIDTVSA HP+LPLLGLLK++GKLV+VGAP +PLELPV  LI GRK V GS  GG+KETQEM+D A KHNITADIE+IS DYVNTAMERLAKADV+YRFVID+ANT+  T
Sbjct:  236 QMKDAMGTMDGIIDTVSATHPLLPLLGLLKNKGKLVMVGAPAEPLELPVFPLIFGRKMVVGSMVGGIKETQEMVDLAGKHNITADIELISADYVNTAMERLAKADVKYRFVIDVANTMKPT 356          
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: CADH8_ARATH (Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.048e-45
Identity = 91/118 (77.12%), Postives = 103/118 (87.29%), Query Frame = -1
Query:  295 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTL 648
            +++ AMGT+DGIIDTVSA H +LPLLGLLK +GKLV+VGAP+KPLELPV+ LI  RK V GS  GG+KETQEMID A KHNITADIE+IS DYVNTAMERL KADVRYRFVID+ANTL
Sbjct:  236 QIKDAMGTMDGIIDTVSATHSLLPLLGLLKHKGKLVMVGAPEKPLELPVMPLIFERKMVMGSMIGGIKETQEMIDMAGKHNITADIELISADYVNTAMERLEKADVRYRFVIDVANTL 353          
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: CADH6_ARATH (Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.016e-44
Identity = 87/122 (71.31%), Postives = 107/122 (87.70%), Query Frame = -1
Query:  283 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTLAATK 648
            +++ AMGT+DGIIDTVSA H I PL+GLLKS GKLVL+GA +KP ++   SLI+GRK+++GS  GGM+ETQEMIDFAA+H I A+IE+ISMDYVNTAM+RLAK DVRYRFVIDI+NTLAAT+
Sbjct:  241 QMKAAMGTMDGIIDTVSASHSISPLIGLLKSNGKLVLLGATEKPFDISAFSLILGRKSIAGSGIGGMQETQEMIDFAAEHGIKAEIEIISMDYVNTAMDRLAKGDVRYRFVIDISNTLAATR 362          
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: MTDH_APIGR (Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.270e-43
Identity = 84/118 (71.19%), Postives = 99/118 (83.90%), Query Frame = -1
Query:  295 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTL 648
            +++GA  +LDGIIDTV   HP+ PL  LLK  GKLV+VGAP+KP ELPV SL+ GRK + G+  GG+KETQEM+DFAAKHNITAD+EVI MDYVNTAMERL K+DVRYRFVIDIANT+
Sbjct:  240 QMKGARSSLDGIIDTVPVNHPLAPLFDLLKPNGKLVMVGAPEKPFELPVFSLLKGRKLLGGTINGGIKETQEMLDFAAKHNITADVEVIPMDYVNTAMERLVKSDVRYRFVIDIANTM 357          
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: GEDH1_OCIBA (Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.270e-43
Identity = 82/118 (69.49%), Postives = 102/118 (86.44%), Query Frame = -1
Query:  295 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTL 648
            ++Q A+GTLDGIIDTVSA HPI+PLL LLK  GKL++VG PDKPL+LPV  LI GR+T++GS  GG+KETQEMIDFAAK+NI AD+EVI +DY+NTAM+RL K+DV+YRFVID+  +L
Sbjct:  240 QMQAAVGTLDGIIDTVSAPHPIVPLLSLLKPHGKLIVVGLPDKPLQLPVFPLIQGRRTIAGSGIGGLKETQEMIDFAAKNNIVADVEVIPIDYINTAMDRLLKSDVKYRFVIDVEKSL 357          
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: CADH9_ARATH (Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=1 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 4.270e-43
Identity = 82/119 (68.91%), Postives = 102/119 (85.71%), Query Frame = -1
Query:  292 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTLA 648
            +++ A+GT+D IIDT+SAVH + PLLGLLK  GKL+ +G P+KPLELP+  L++GRK V GS  GGMKETQEM+DF AKHNITADIE+I MD +NTAMERLAK+DVRYRFVID+AN+L+
Sbjct:  240 KMKAAIGTMDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGMKETQEMLDFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFVIDVANSLS 358          
BLAST of CX043359 vs. ExPASy Swiss-Prot
Match: MTDH3_STYHU (Probable mannitol dehydrogenase 3 OS=Stylosanthes humilis GN=CAD3 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 6.817e-41
Identity = 82/121 (67.77%), Postives = 99/121 (81.82%), Query Frame = -1
Query:  286 RLQGAMGTLDGIIDTVSAVHPILPLLGLLKSQGKLVLVGAPDKPLELPVISLIMGRKTVSGSSTGGMKETQEMIDFAAKHNITADIEVISMDYVNTAMERLAKADVRYRFVIDIANTLAAT 648
            +++    TLDGIIDTVSA H I+PL+GLLKS GKLVL+GA +KPLELP   LI+GRK V G+  GG+KETQEMIDF+ KHN+  +IEV+ MDYVN AM+RLAKADV+YRFVID+ANTL  T
Sbjct:  242 QMEAPKETLDGIIDTVSADHSIVPLIGLLKSHGKLVLIGAIEKPLELPPFPLILGRKLVGGTLVGGLKETQEMIDFSPKHNVKPEIEVVPMDYVNIAMQRLAKADVKYRFVIDVANTLKPT 362          
The following BLAST results are available for this feature:
BLAST of CX043359 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
MTDH_MESCR1.515e-4877.50Probable mannitol dehydrogenase OS=Mesembryanthemu... [more]
MTDH_FRAAN4.408e-4878.81Probable mannitol dehydrogenase OS=Fragaria ananas... [more]
MTDH_PETCR1.086e-4674.58Mannitol dehydrogenase (Fragment) OS=Petroselinum ... [more]
CADH7_ARATH1.086e-4675.21Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis th... [more]
CADH8_ARATH2.048e-4577.12Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis th... [more]
CADH6_ARATH1.016e-4471.31Probable cinnamyl alcohol dehydrogenase 6 OS=Arabi... [more]
MTDH_APIGR4.270e-4371.19Mannitol dehydrogenase OS=Apium graveolens GN=MTD ... [more]
GEDH1_OCIBA4.270e-4369.49Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GE... [more]
CADH9_ARATH4.270e-4368.91Probable cinnamyl alcohol dehydrogenase 9 OS=Arabi... [more]
MTDH3_STYHU6.817e-4167.77Probable mannitol dehydrogenase 3 OS=Stylosanthes ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10E10_b Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10E10-J20-1-7.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043359 ID=CX043359; Name=CX043359; organism=Citrus sinensis; type=EST; length=648bp
TTTTTTTTTTTTTTTGATTTAGAACAAAACAAACTTTTCAACTGGACAAT
TGGTGAAAGGTACATATGCTAAATATTTTATATGAACAATGTTTTATTTC
ATTAACATTTATAGTTTTTTGGCAATCACGACATAATTAGGGTGATGTAA
CTGGAAATTAAAAGTAATTTAAGCGCTAAAAGAGTGTAATGATCGAGGGA
GCATTACATATAGCAAAGTGGATCATGGAACAAAGTTGTGAATTGAAGAC
ACCAATCTGATTCTGATTCTGATTCTTCAAGGTTTGGTGGCGGCCAAGGT
GTTTGCAATATCAATGACAAATCGATACCGAACATCAGCCTTGGCGAGCC
GCTCCATTGCCGTATTGACATAATCCATCGAAATAACCTCAATGTCAGCT
GTTATATTGTGTTTTGCTGCAAAATCAATCATCTCTTGCGTCTCTTTCAT
TCCCCCAGTGCTGCTCCCTGACACCGTCTTCCTCCCCATAATTAAGGAAA
TCACAGGTAGCTCGAGTGGCTTGTCCGGAGCACCAACCAGAACAAGCTTG
CCCTGGGACTTTAATAGACCGAGCAATGGCAAAATGGGGTGCACAGCGGA
CACCGTGTCAATAATACCATCCAATGTGCCCATGGCACCCTGCAACCT
back to top