CX043355

Overview
NameCX043355
Unique NameCX043355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length746
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: MPPB_ARATH (Probable mitochondrial-processing peptidase subunit beta OS=Arabidopsis thaliana GN=At3g02090 PE=1 SV=2)

HSP 1 Score: 306.605 bits (784), Expect = 9.198e-83
Identity = 149/171 (87.13%), Postives = 162/171 (94.74%), Query Frame = -2
Query:  233 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYWNRY 745
            MLGSWNKN  GGKH+GS+L QRV INEIAES+MAFNTNYKDTGLFGVYAVAK DCLDDL+YAIMYE TKLAYRVS+ADVTRARNQLKSSLLLH+DGTSP+AEDIGRQLLTYGRRIP AELFARID+VDASTVKRVAN++IYD+DIAI+A+GPIQ LPDYN FRRRTYWNRY
Sbjct:  361 MLGSWNKNVGGGKHVGSDLTQRVAINEIAESIMAFNTNYKDTGLFGVYAVAKADCLDDLSYAIMYEVTKLAYRVSDADVTRARNQLKSSLLLHMDGTSPIAEDIGRQLLTYGRRIPTAELFARIDAVDASTVKRVANKYIYDKDIAISAIGPIQDLPDYNKFRRRTYWNRY 531          
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: MPPB_MOUSE (Mitochondrial-processing peptidase subunit beta OS=Mus musculus GN=Pmpcb PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.659e-39
Identity = 76/170 (44.71%), Postives = 117/170 (68.82%), Query Frame = -2
Query:  236 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYWNR 745
            ++G+W+++  GG ++ S+LAQ      +  S  +FNT+Y DTGL+G+Y V +   + D+ + +  E  +L   V+E++V RA+N LK+++LL +DG++P+ EDIGRQ+L Y RRIP  EL ARID+VDA TV+RV  ++I+D+  AIAA+GPI+ LPD+N       W R
Sbjct:  319 LIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYTDTGLWGLYMVCEQATVADMLHVVQNEWKRLCTDVTESEVARAKNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVDAETVRRVCTKYIHDKSPAIAALGPIERLPDFNQICSNMRWIR 488          
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: MPPB_PONAB (Mitochondrial-processing peptidase subunit beta OS=Pongo abelii GN=PMPCB PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.779e-39
Identity = 75/170 (44.12%), Postives = 116/170 (68.24%), Query Frame = -2
Query:  236 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYWNR 745
            ++G+W+++  GG ++ S+LAQ      +  S  +FNT+Y DTGL+G+Y V +P  + D+ + +  E  +L   V+E++V RARN LK+++LL +DG++P+ EDIGRQ+L Y RRIP  EL ARID+V+A T++ V  ++IY+R  AIAA+GPI+ LPD+        W R
Sbjct:  319 LIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYTDTGLWGLYMVCEPSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIEQLPDFKQICSNMCWLR 488          
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: MPPB_RAT (Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus GN=Pmpcb PE=1 SV=3)

HSP 1 Score: 160.999 bits (406), Expect = 6.242e-39
Identity = 76/170 (44.71%), Postives = 115/170 (67.65%), Query Frame = -2
Query:  236 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYWNR 745
            ++G+W+++  GG ++ S+LAQ      +  S  +FNT+Y DTGL+G+Y V +   + D+ +A+  E  +L   VSE++V RA+N LK+++LL +DG++P+ EDIGRQ+L Y RRIP  EL ARID+VDA  V+ V  ++IY +  AIAA+GPI+ LPD+N       W R
Sbjct:  319 LIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYTDTGLWGLYMVCEQATVADMLHAVQKEWMRLCTAVSESEVARAKNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVDAEMVREVCTKYIYGKSPAIAALGPIERLPDFNQICSNMRWTR 488          
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: MPPB_HUMAN (Mitochondrial-processing peptidase subunit beta OS=Homo sapiens GN=PMPCB PE=1 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 6.242e-39
Identity = 75/170 (44.12%), Postives = 116/170 (68.24%), Query Frame = -2
Query:  236 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYWNR 745
            ++G+W+++  GG ++ S+LAQ      +  S  +FNT+Y DTGL+G+Y V +   + D+ + +  E  +L   V+E++V RARN LK+++LL +DG++P+ EDIGRQ+L Y RRIP  EL ARID+V+A T++ V  ++IY+R  AIAA+GPI+ LPD+   R    W R
Sbjct:  319 LIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYTDTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLR 488          
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: MPPB_BOVIN (Mitochondrial-processing peptidase subunit beta OS=Bos taurus GN=PMPCB PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.391e-38
Identity = 72/168 (42.86%), Postives = 115/168 (68.45%), Query Frame = -2
Query:  242 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYW 745
            ++G+W+++  GG ++ S+LAQ      +  S  +FNT+Y DTGL+G+Y V +P  + D+ + +  E  +L   V+E++V RA+N LK+++LL +DG++P+ EDIGRQ+L Y RRIP  EL ARID+V+A  ++ V  ++IYD+  A+AA+GPI+ LPD+N       W
Sbjct:  320 LIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYTDTGLWGIYMVCEPATVADMLHVVQKEWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAEIIREVCTKYIYDKSPAVAAVGPIEQLPDFNQICSNMRW 487          
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: MPPB_BLAEM (Mitochondrial-processing peptidase subunit beta OS=Blastocladiella emersonii GN=MPP1 PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.046e-38
Identity = 86/172 (50.00%), Postives = 116/172 (67.44%), Query Frame = -2
Query:  233 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKP-DCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYWNRY 745
            M+GS+++ + G  H  S+LAQ V  + +A S  +FNT Y DTGL+G+Y  +   D LDDLA+  + E  +LA   SE +V  A+ QLK+SLLL +DGT+PVAE+IGRQ+L YGRR+   E+   +D+V    VKRVAN FIYDRD+AI A+GP++ LPDYN  R      RY
Sbjct:  295 MIGSYDR-AAGNAHPSSKLAQIVAKHNLANSFTSFNTTYSDTGLWGIYIQSNNRDNLDDLAHFTVREWMRLATAPSEGEVAIAKQQLKTSLLLALDGTTPVAEEIGRQMLAYGRRLSPFEIDRLVDAVTVEDVKRVANEFIYDRDLAIVAVGPVECLPDYNRIRSAMNLLRY 465          
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: QCR1_MOUSE (Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus GN=Uqcrc1 PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.455e-35
Identity = 70/171 (40.94%), Postives = 108/171 (63.16%), Query Frame = -2
Query:  233 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYWNRY 745
            ++G ++    GG H+ S LA     N++ +S   FN +Y DTGL G + V     +DD+ + +  +  +L    +E++VTR +N L+++L+ H+DGT+PV EDIGR LLTYGRRIP AE  +RI  VDA  ++ + +++ YD+  A+A  GPI+ LPDYN  R   +W R+
Sbjct:  310 IIGHYDCTCGGGVHLSSPLASVAVANKLCQSFQTFNISYSDTGLLGAHFVCDAMSIDDMVFFLQGQWMRLCTSATESEVTRGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIQEVDAQMLRDICSKYFYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF 480          
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: QCR1_BOVIN (Cytochrome b-c1 complex subunit 1, mitochondrial OS=Bos taurus GN=UQCRC1 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 4.187e-35
Identity = 71/171 (41.52%), Postives = 106/171 (61.99%), Query Frame = -2
Query:  233 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYWNRY 745
            ++G ++    GG H+ S LA     N++ +S   FN  Y DTGL G + V     +DD+ + +  +  +L    +E++V R +N L+++L+ H+DGT+PV EDIGR LLTYGRRIP AE  +RI  VDA  V+ V +++ YD+  A+A  GPI+ LPDYN  R   +W R+
Sbjct:  310 IIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF 480          
BLAST of CX043355 vs. ExPASy Swiss-Prot
Match: QCR1_RAT (Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus GN=Uqcrc1 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 9.327e-35
Identity = 70/171 (40.94%), Postives = 108/171 (63.16%), Query Frame = -2
Query:  233 MLGSWNKNSVGGKHMGSELAQRVGINEIAESMMAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDSVDASTVKRVANRFIYDRDIAIAAMGPIQGLPDYNWFRRRTYWNRY 745
            ++G ++    GG H+ S LA     N++ +S   FN +Y +TGL G + V     +DD+ + +  +  +L    +E++VTR +N L+++L+ H+DGT+PV EDIGR LLTYGRRIP AE  +RI+ VDA  V+ V +++ YD+  A+A  GPI+ L DYN  R   +W R+
Sbjct:  310 IIGHYDCTYGGGVHLSSPLASVAVANKLCQSFQTFNISYSETGLLGAHFVCDAMSIDDMIFFLQGQWMRLCTSATESEVTRGKNILRNALISHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIEEVDAQMVREVCSKYFYDQCPAVAGYGPIEQLSDYNRIRSGMFWLRF 480          
The following BLAST results are available for this feature:
BLAST of CX043355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
MPPB_ARATH9.198e-8387.13Probable mitochondrial-processing peptidase subuni... [more]
MPPB_MOUSE3.659e-3944.71Mitochondrial-processing peptidase subunit beta OS... [more]
MPPB_PONAB4.779e-3944.12Mitochondrial-processing peptidase subunit beta OS... [more]
MPPB_RAT6.242e-3944.71Mitochondrial-processing peptidase subunit beta OS... [more]
MPPB_HUMAN6.242e-3944.12Mitochondrial-processing peptidase subunit beta OS... [more]
MPPB_BOVIN1.391e-3842.86Mitochondrial-processing peptidase subunit beta OS... [more]
MPPB_BLAEM4.046e-3850.00Mitochondrial-processing peptidase subunit beta OS... [more]
QCR1_MOUSE2.455e-3540.94Cytochrome b-c1 complex subunit 1, mitochondrial O... [more]
QCR1_BOVIN4.187e-3541.52Cytochrome b-c1 complex subunit 1, mitochondrial O... [more]
QCR1_RAT9.327e-3540.94Cytochrome b-c1 complex subunit 1, mitochondrial O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10E08_b Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10E08-J16-1-7.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043355 ID=CX043355; Name=CX043355; organism=Citrus sinensis; type=EST; length=746bp
TTTTTTTTTTTTAATCCGAGGGCCAAATCACTGAAGAGTGAAGACAGCTT
ACTTATTTCCTGAACAAATTATGAAGTTACAGAAGCAAGAGCTAGAAAAG
AATTCAATAAAATACCATAGCCCTGAAGCCTCTCCCAAGGGCATTGATTG
TGTAAATTGCAACCCAAAAATTGTTTGAAATCTCCGCCCAGGAAGGCGGG
GATGCAGTAATGAACAACCATGAGATAACTTAGTATCTATTCCAGTAGGT
TCTGCGTCTGAACCAGTTGTAGTCGGGTAAACCTTGAATTGGACCCATTG
CAGCAATTGCGATATCCCTGTCGTAAATAAATCTGTTTGCAACGCGCTTG
ACAGTGCTTGCATCTACGGAGTCTATCCTAGCAAACAATTCAGCAAATGG
GATTCTTCGACCATATGTAAGCAGCTGGCGTCCAATATCTTCAGCTACAG
GGCTTGTTCCATCAATGTGAAGCAACAGGGATGATTTCAACTGATTACGG
GCACGAGTGACATCAGCTTCTGAAACCCGATAAGCTAACTTGGTAGTCTC
GTACATAATTGCATAGGCCAAATCATCTAAGCAATCCGGCTTAGCAACAG
CATAAACACCAAACAGACCAGTGTCTTTGTAGTTCGTGTTGAAGGCCATC
ATGCTTTCTGCAATTTCATTAATGCCAACTCTCTGTGCCAGCTCGGAACC
CATGTGCTTTCCACCCACTGAATTTTTATTCCATGAACCCAACATT
back to top