EY660287

Overview
NameEY660287
Unique NameEY660287
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length606
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1389 contig Csv1_Contig1389:198..803. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY660287 vs. ExPASy Swiss-Prot
Match: PST2_ARATH (Photosystem II 5 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=PSBT PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 7.546e-12
Identity = 42/96 (43.75%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  101 SLAKNPAATRAKRGGLIVVAKAASSKAENVSMEFKNKDESSSNGRRELVFXXXXXXXXXXXXXXXXESEEPKRGTPYAKKKYAPVCVTMPTARICR 388
            ++AK P+AT  +R  L VV  + S    ++ +    K++SS+  RR+L+F                E EEPKRGT  AKKKYA VCVTMPTA+ICR
Sbjct:   13 AVAKVPSATGGRR--LSVVRASTSDNTPSLEV----KEQSSTTMRRDLMFTAAAAAVCSLAKVAMAEEEEPKRGTEAAKKKYAQVCVTMPTAKICR 102          
The following BLAST results are available for this feature:
BLAST of EY660287 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PST2_ARATH7.546e-1243.75Photosystem II 5 kDa protein, chloroplastic OS=Ara... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-020-E11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY660287 ID=EY660287; Name=EY660287; organism=Citrus sinensis; type=EST; length=606bp
CCTTCTAAAACACGCGTCCGGTCAAAGAGTGTCACAAAAAAGAATGTCAG
CAGCAAACATGGCTTCGATGACCATGGCAGCAGCTTGCTTCATGAACACA
AGCTTGGCCAAAAACCCAGCAGCAACAAGAGCGAAGAGAGGAGGCCTCAT
CGTTGTGGCCAAGGCTGCATCATCAAAAGCTGAAAATGTGAGCATGGAAT
TCAAGAACAAGGATGAGAGCAGCAGCAACGGAAGAAGGGAGCTTGTGTTT
GCAGCAGCAGCTGCAGCAGCTTGCTCCATTGCAAAAGTTGCAATGGCTGA
ATCTGAGGAGCCCAAACGAGGGACCCCATATGCTAAGAAGAAGTATGCTC
CTGTTTGTGTCACAATGCCTACTGCTAGAATCTGTCGCAAGTGAGAATGT
TTTTTAATTTTCATGCTGTTGATGTTAATTAGTGTCCAATTAATTGATAT
GAGATCAATGTTAAAAGCTGTGAGCATCTGTATCTTGTAATTGGAGAATC
CTGTTTATTTTATCTTGTCTTTGTTACCCTTCCCTCCAATTTTTGGTTTT
CTATTAATTTCATTATATAGTATAATCCCAATTCCCCGCTGAAAAAAAAA
AAAAAA
back to top