CX043354

Overview
NameCX043354
Unique NameCX043354
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length791
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX043354 vs. ExPASy Swiss-Prot
Match: YG41_SCHPO (Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe GN=SPBC23E6.01c PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 6.665e-26
Identity = 67/153 (43.79%), Postives = 84/153 (54.90%), Query Frame = -1
Query:  357 RFGDESEQLRAMTEMNGVFCSTRPMRIGPATNKK--------TVSGQQQYPKASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPSNKQAQPDPN 791
            RF DE++Q  A+ EM G  C  RP+R+G AT K          V      P   Y  +Q      D  N+TVFVG L   V++E L+ LF  +G++V+VKIP GK CGFVQF +R  AE A+  L G  LG   IRLSWGR+  N  A P  N
Sbjct:  234 RFTDENDQKSALAEMQGQICGDRPIRVGLATPKSKAHVFSPVNVVPVSMPPVGFYSAAQPVPQFADTANSTVFVGGLSKFVSEEELKYLFQNFGEIVYVKIPPGKGCGFVQFVNRQSAEIAINQLQGYPLGNSRIRLSWGRN-QNPIAAPALN 385          
BLAST of CX043354 vs. ExPASy Swiss-Prot
Match: NAM8_YEAST (Protein NAM8 OS=Saccharomyces cerevisiae GN=NAM8 PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.536e-22
Identity = 67/207 (32.37%), Postives = 98/207 (47.34%), Query Frame = -1
Query:  339 RFGDESEQLRAMTEMNGVFCSTRPMRIGPATNKKT-VSGQQQYPKAS----------------------------YQNSQVAQ------------SDDDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPSN---------------KQAQPDPNQWNAGY 791
            +F +  EQ  A++EM GVF + R +++GP + ++  VSG   Y ++S                            ++ + ++Q               DPNNTTVF+G L S+VT++ LR  F  +G +V+VKIP GK CGFVQ+ DR  AE A+  + G  +    +RLSWGRS                  +Q QP   Q N GY
Sbjct:  211 KFTNSDEQQLALSEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRSAKQTALLQQAMLSNSLQVQQQQPGLQQPNYGY 417          
BLAST of CX043354 vs. ExPASy Swiss-Prot
Match: CSX1_SCHPO (RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe GN=csx1 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.943e-21
Identity = 55/140 (39.29%), Postives = 80/140 (57.14%), Query Frame = -1
Query:  390 RFGDESEQLRAMTEMNGVFCSTRPMRIGPATNKKTVS----GQQQYPKASYQNSQVAQS--DDDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRS 791
            RF  E EQ  A+  M G  C  RP+RI  A+ K   S            S  N Q  Q     DP NTTVFVG L S ++++ L+  F  +G+++++KIP GK CGFVQ++++S AE+A+  + G  +G  +IRL+WG +
Sbjct:  230 RFSSEKEQQHALMHMQGYLCQGRPLRISVASPKSRASIAADSALGIVPTSTSNRQPNQDLCSMDPLNTTVFVGGLASNLSEKDLQVCFQPFGRILNIKIPFGKGCGFVQYSEKSAAEKAINTMQGALVGTSHIRLAWGHN 369          
BLAST of CX043354 vs. ExPASy Swiss-Prot
Match: NGR1_YEAST (Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae GN=NGR1 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 1.139e-17
Identity = 68/216 (31.48%), Postives = 95/216 (43.98%), Query Frame = -1
Query:  321 RFGDESEQLRAMTEMNGVFCSTRPMRIGPATNKKTV-------SGQQQYPKASYQ----------------------------------------------NSQVAQS------DDDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPSNKQAQPDPNQWNAGYYGYAQG 791
            RFGDE E+ RA+ EM+G +   R +R+  AT +  +         QQQ  +  +Q                                              N +V  S      + DP NTTVFVG L    T+  LR LF  +G +++V+IP GK CGFV+F  R  AE +++ L G  +GG  IRLSWGR PS+  A+ +     A  Y  + G
Sbjct:  240 RFGDEDERRRALIEMSGKWFQGRALRVAYATPRNNMMLQLQEQQQQQQQLQQQHQQLDQEDNNGPLLIKTANNLIQNNSNMLPLNALHNAPPMHLNEGGISNMRVNDSLPSNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWGR-PSSSNAKTNSTIMGASQYMSSNG 454          
BLAST of CX043354 vs. ExPASy Swiss-Prot
Match: TIA1_MOUSE (Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.441e-12
Identity = 49/167 (29.34%), Postives = 83/167 (49.70%), Query Frame = -1
Query:  309 AMTEMNGVFCSTRPMRIGPATNKKTVSGQQQYPKASYQNSQVAQSDDD------PNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGR------SPSNKQAQ----PDPNQWNAGYYGYAQGYENY 761
            A+ +M G +   R +R   AT K         PK++Y+++    S D+      PNN TV+ G + S +T++ +R+ FS +GQ++ +++   K   FV+F+    A  A+  +NGT + G  ++  WG+      +P  +Q Q    P   QW   +YG AQ    Y
Sbjct:  163 AIQQMGGQWLGGRQIRTNWATRKPPA------PKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPPTYGQWGQ-WYGNAQQIGQY 322          
BLAST of CX043354 vs. ExPASy Swiss-Prot
Match: TIAR_MOUSE (Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.194e-12
Identity = 46/165 (27.88%), Postives = 77/165 (46.67%), Query Frame = -1
Query:  309 FGDESEQLRAMTEMNGVFCSTRPMRIGPATNKKTVSGQQQYPKASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGR-SP--SNKQAQPDPNQWN--AGYYGYAQGYENY 788
            F ++ +   A+  M G +   R +R   AT K       Q         +   +   P N TV+ G + S +TD+ +R+ FS +GQ++ +++   K   FV+F+    A  A+  +NGT + G  ++  WG+ SP  +    Q D +QW   +  YG  Q Y  Y
Sbjct:  162 FYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQY 326          
BLAST of CX043354 vs. ExPASy Swiss-Prot
Match: TIAR_HUMAN (Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.477e-12
Identity = 46/165 (27.88%), Postives = 77/165 (46.67%), Query Frame = -1
Query:  309 FGDESEQLRAMTEMNGVFCSTRPMRIGPATNKKTVSGQQQYPKASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGR-SP--SNKQAQPDPNQWN--AGYYGYAQGYENY 788
            F ++ +   A+  M G +   R +R   AT K       Q         +   +   P N TV+ G + S +TD+ +R+ FS +GQ++ +++   K   FV+F+    A  A+  +NGT + G  ++  WG+ SP  +    Q D +QW   +  YG  Q Y  Y
Sbjct:  145 FYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQY 309          
BLAST of CX043354 vs. ExPASy Swiss-Prot
Match: YBKC_SCHPO (Uncharacterized RNA-binding protein C1289.12 OS=Schizosaccharomyces pombe GN=SPBC1289.12 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 9.343e-12
Identity = 43/134 (32.09%), Postives = 65/134 (48.51%), Query Frame = -1
Query:  384 DESEQLRAMTEMNGVFCSTRPMRIGPA-TNKKTVSGQQQYPKASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPS 782
            +ES+   A  EM G FC  R + +    ++K T      +    Y   Q      DPNNT V+V  L   +T + LR  F  +G++++ ++      G + FA R  AE+A+  +N   L G  I+LSW R PS
Sbjct:  121 NESDIQNAQVEMQGAFCLKRSILVHSVKSDKNTYLSSPGF----YGTPQPLNQFTDPNNTAVYVHQLPENITTQELRSYFLHFGEILYTQV--NNNSGRIVFAQRYFAEQAINEMNNFPLHGVRIQLSWARPPS 248          
BLAST of CX043354 vs. ExPASy Swiss-Prot
Match: TIA1_HUMAN (Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3)

HSP 1 Score: 70.4774 bits (171), Expect = 1.220e-11
Identity = 49/167 (29.34%), Postives = 83/167 (49.70%), Query Frame = -1
Query:  309 AMTEMNGVFCSTRPMRIGPATNKKTVSGQQQYPKASYQNSQVAQSDDD------PNNTTVFVGNLDSIVTDEHLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGR------SPSNKQAQ---PDP-NQWNAGYYGYAQGYENY 761
            A+ +M G +   R +R   AT K         PK++Y+++    S D+      P+N TV+ G + S +T++ +R+ FS +GQ++ +++   K   FV+F     A  A+  +NGT + G  ++  WG+      +P  +Q Q   P P  QW   +YG AQ    Y
Sbjct:  163 AIQQMGGQWLGGRQIRTNWATRKPPA------PKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQ-WYGNAQQIGQY 322          
The following BLAST results are available for this feature:
BLAST of CX043354 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
YG41_SCHPO6.665e-2643.79Uncharacterized RNA-binding protein C23E6.01c OS=S... [more]
NAM8_YEAST1.536e-2232.37Protein NAM8 OS=Saccharomyces cerevisiae GN=NAM8 P... [more]
CSX1_SCHPO4.943e-2139.29RNA-binding post-transcriptional regulator csx1 OS... [more]
NGR1_YEAST1.139e-1731.48Negative growth regulatory protein NGR1 OS=Sacchar... [more]
TIA1_MOUSE1.441e-1229.34Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=... [more]
TIAR_MOUSE4.194e-1227.88Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=2 SV=... [more]
TIAR_HUMAN5.477e-1227.88Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=... [more]
YBKC_SCHPO9.343e-1232.09Uncharacterized RNA-binding protein C1289.12 OS=Sc... [more]
TIA1_HUMAN1.220e-1129.34Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=T... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10E07_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10E07-J14-1-6.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043354 ID=CX043354; Name=CX043354; organism=Citrus sinensis; type=EST; length=791bp
ATAACAATAAGTAGTACTCACAAAAATTTTATGAGAATGAACGTTCATAC
AACACATAGCGATATTAAGAAAAAGATAAGGGTACAGAGCCTGAACTGGT
TTCCTCCAGAGAGGACAGGAAGAAAGATCATTGTAGTAGTATCACACCAT
TAAGTTACTGCTACAATAAAAAGCAGTCACATAAACAAAAACTCCTCATC
AATATCCACTTCCTACTGCTGTGGTTGCTGGGGCTGCTGATAATTTCCAT
ATCCTGGATATCCTCCGTAGTACATGCTAGGGTCTTGCGGAGCAGCAGCC
GCATAACCATAATTCTCATAACCTTGGGCATATCCATAGTATCCAGCATT
CCACTGGTTTGGGTCTGGCTGAGCCTGTTTGTTTGAAGGACTACGTCCCC
ATGATAGCCGGATATTTTGTCCTCCCAACTGAGTTCCATTTAACATTCTC
AATGCTTCCTCTGCACAACTTCTGTCAGCAAATTGAACAAATCCACATCG
CTTGCCTGCTGGTATTTTCACATGTACTAGTTGCCCATATTGGCTGAACA
GTTCTCTCAAATGTTCATCCGTAACAATAGAGTCCAGATTACCAACAAAC
ACCGTTGTATTATTTGGATCGTCATCACTCTGTGCCACTTGAGAATTCTG
ATATGAAGCTTTAGGGTACTGCTGCTGACCTGAAACAGTTTTCTTATTAG
TAGCTGGACCAATCCGCATTGGTCTCGTAGAACAAAAGACACCATTCATC
TCAGTCATGGCACGTAGCTGTTCACTTTCATCACCAAATCT
back to top