DT214601

Overview
NameDT214601
Unique NameDT214601
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6531 contig Csv1_Contig6531:1..862. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: OPD22_ARATH (Dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At3g13930 PE=1 SV=2)

HSP 1 Score: 285.419 bits (729), Expect = 2.777e-76
Identity = 136/154 (88.31%), Postives = 146/154 (94.81%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            NSSW DEYIRQFKNVNINVAVQTENGLYVPV++DADKKGLSTI EEVR LAQKAK+NSLKP+DYEGGTFTV+NLGGPFGIKQFCA+INPPQ+ ILA+GSAEKRVVPG GPDQY  +S+MSVTLSCDHRVIDGAIGAEWLKAFKGYIE PESMLL
Sbjct:  386 NSSWTDEYIRQFKNVNINVAVQTENGLYVPVVKDADKKGLSTIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAVINPPQAAILAIGSAEKRVVPGTGPDQYNVASYMSVTLSCDHRVIDGAIGAEWLKAFKGYIETPESMLL 539          
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: OPD23_ARATH (Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana GN=At1g54220 PE=1 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 2.351e-75
Identity = 132/154 (85.71%), Postives = 147/154 (95.45%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            NSSW D+YIRQFKNVNINVAVQTENGLYVPV++DAD+KGLSTI EEVR LAQKAK+NSLKP+DYEGGTFTV+NLGGPFGIKQFCA++NPPQ+ ILAVGSAEKRVVPG GPDQ+ F+S+M VTLSCDHRV+DGAIGAEWLKAFKGYIENP+SMLL
Sbjct:  386 NSSWTDDYIRQFKNVNINVAVQTENGLYVPVVKDADRKGLSTIGEEVRLLAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAVVNPPQAAILAVGSAEKRVVPGNGPDQFNFASYMPVTLSCDHRVVDGAIGAEWLKAFKGYIENPKSMLL 539          
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: ODP2_DICDI (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Dictyostelium discoideum GN=pdhC PE=2 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 3.537e-47
Identity = 88/155 (56.77%), Postives = 121/155 (78.06%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQ-YKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            NS+W D++IR++ N++INVAV T  GL+ P++R  D KGL++I+  V+QLA+KA++  L P ++E GTFT++NL G  GIKQF A+INPPQ+ ILAVG+ E RVV    PD  Y+ ++ +SVTLSCDHRVIDGA+GAEWLK+FK Y+ENP  ++L
Sbjct:  482 NSTWTDQFIRRYHNIDINVAVNTPQGLFTPIVRGVDMKGLNSISTSVKQLAEKAQNGKLHPSEFESGTFTISNL-GMLGIKQFAAVINPPQAAILAVGTTETRVVLSNKPDSPYETATILSVTLSCDHRVIDGAVGAEWLKSFKDYVENPIKLIL 635          
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: ODP2_RAT (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Rattus norvegicus GN=Dlat PE=1 SV=3)

HSP 1 Score: 169.474 bits (428), Expect = 2.221e-41
Identity = 83/154 (53.90%), Postives = 112/154 (72.73%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            NSSW D  IRQ   V+++VAV T  GL  P++ +A  KGL TIA +V  LA KA++  L+P +++GGTFT++NLG  FGIK F AIINPPQ+ ILA+G++E +++P      +  +S MSVTLSCDHRV+DGA+GA+WL  FK Y+E P +MLL
Sbjct:  480 NSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLG-MFGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPVTMLL 632          
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: ODP2_MOUSE (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dlat PE=1 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 2.900e-41
Identity = 83/154 (53.90%), Postives = 112/154 (72.73%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            NSSW D  IRQ   V+++VAV T  GL  P++ +A  KGL TIA +V  LA KA++  L+P +++GGTFT++NLG  FGIK F AIINPPQ+ ILA+G++E +++P      +  +S MSVTLSCDHRV+DGA+GA+WL  FK Y+E P +MLL
Sbjct:  490 NSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQPHEFQGGTFTISNLG-MFGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMLL 642          
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: ODP2_HUMAN (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DLAT PE=1 SV=3)

HSP 1 Score: 167.162 bits (422), Expect = 1.102e-40
Identity = 82/154 (53.25%), Postives = 112/154 (72.73%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            NSSW D  IRQ   V+++VAV T  GL  P++ +A  KG+ TIA +V  LA KA++  L+P +++GGTFT++NLG  FGIK F AIINPPQ+ ILA+G++E ++VP      +  +S MSVTLSCDHRV+DGA+GA+WL  F+ Y+E P +MLL
Sbjct:  495 NSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGVETIANDVVSLATKAREGKLQPHEFQGGTFTISNLG-MFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL 647          
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: ODP2_RICBR (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia bellii (strain RML369-C) GN=pdhC PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 5.470e-40
Identity = 81/154 (52.60%), Postives = 115/154 (74.68%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            N+SW D+ IR + NV+I+VAV  ENGL  P+IR+AD+K +  ++ E++ L +KA++N L P++++GG FT++NL G +GIK F AIINPPQS I+ VGS+ KR +  +  DQ   ++ M VTLS DHRV+DGA+GAE+L AFK +IE+P  MLL
Sbjct:  265 NASWGDDAIRYYNNVDISVAVAIENGLVTPIIRNADQKNIVDLSSEMKGLIKKARENKLTPEEFQGGGFTISNL-GMYGIKNFNAIINPPQSCIMGVGSSSKRAI--VKNDQISIATIMDVTLSADHRVVDGAVGAEFLAAFKRFIESPALMLL 415          
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: ODP2_CAEEL (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=F23B12.5 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 7.898e-39
Identity = 79/154 (51.30%), Postives = 109/154 (70.78%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            NS W D +IR+  +V+++VAV T  GL  P+I +A  KGL+TIA E+ +LAQ+A++  L+P +++GGTFTV+NLG    +  F AIINPPQS ILA+G A  ++VP    + YK    M VTLSCDHR +DGA+GA WL+ FK ++E P +MLL
Sbjct:  355 NSYWMDSFIRENHHVDVSVAVSTPAGLITPIIFNAHAKGLATIASEIVELAQRAREGKLQPHEFQGGTFTVSNLGMFGSVSDFTAIINPPQSCILAIGGASDKLVPD-EAEGYKKIKTMKVTLSCDHRTVDGAVGAVWLRHFKEFLEKPHTMLL 507          
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: ODP2_RICFE (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia felis GN=pdhC PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.760e-38
Identity = 77/154 (50.00%), Postives = 115/154 (74.68%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            N+SW ++ IR   NV+I+VAV  ENGL  P++++A++K +  ++ E+++L +KAKDN L P++++GG FT++NL G +GIK F AIINPPQS I+ VG++ KR +  +  DQ   ++ M VTLS DHRV+DGA+GAE+L AFK +IE+P  ML+
Sbjct:  262 NASWGEDAIRYHNNVDISVAVAIENGLVTPIVKNANQKNIIELSREMKELIKKAKDNKLTPEEFQGGGFTISNL-GMYGIKNFNAIINPPQSCIMGVGASAKRAI--VKNDQVTIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPALMLI 412          
BLAST of DT214601 vs. ExPASy Swiss-Prot
Match: ODP2_RICCN (Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Rickettsia conorii GN=pdhC PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.298e-38
Identity = 77/154 (50.00%), Postives = 115/154 (74.68%), Query Frame = -2
Query:  400 NSSWADEYIRQFKNVNINVAVQTENGLYVPVIRDADKKGLSTIAEEVRQLAQKAKDNSLKPQDYEGGTFTVTNLGGPFGIKQFCAIINPPQSGILAVGSAEKRVVPGLGPDQYKFSSFMSVTLSCDHRVIDGAIGAEWLKAFKGYIENPESMLL 861
            N+SW ++ IR + NV+I+VAV  ENGL  P++++A++K +  ++ E++ L +KAKDN L P++++GG FT++NL G +GIK F AIINPPQS I+ VG++ KR +  +  DQ   ++ M VTLS DHRV+DGA+GAE+L AFK +IE+P  ML+
Sbjct:  262 NASWGEDAIRYYNNVDISVAVAIENGLVTPIVKNANQKNILELSREMKALIKKAKDNKLTPEEFQGGGFTISNL-GMYGIKNFNAIINPPQSCIMGVGASAKRAI--VKNDQITIATIMDVTLSADHRVVDGAVGAEFLVAFKKFIESPVLMLI 412          
The following BLAST results are available for this feature:
BLAST of DT214601 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 94
Match NameE-valueIdentityDescription
OPD22_ARATH2.777e-7688.31Dihydrolipoyllysine-residue acetyltransferase comp... [more]
OPD23_ARATH2.351e-7585.71Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_DICDI3.537e-4756.77Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RAT2.221e-4153.90Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_MOUSE2.900e-4153.90Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_HUMAN1.102e-4053.25Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICBR5.470e-4052.60Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_CAEEL7.898e-3951.30Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICFE1.760e-3850.00Dihydrolipoyllysine-residue acetyltransferase comp... [more]
ODP2_RICCN2.298e-3850.00Dihydrolipoyllysine-residue acetyltransferase comp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_06N13_f2 Parent Washington Navel Orange Red Scale-Infested Rind cDNA Library UCRCS11-2 Citrus sinensis cDNA clone CS_WEd0006c_G07_VN, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214601 ID=DT214601|Name=DT214601|organism=Citrus sinensis|type=EST|length=862bp
GTTGTTTCACACAACACTGGTAATTGGAAAATCCAAAAAATATATATAAA
TCAAATTATTACCCGCATGAAAGAGGCGATTACACTCTACTAAAATCATG
TTCATCACGTATGTAACCCAAAAATCCATTAAGGAAAGGTCGATAGCAGA
ACACCTTGTTGAACACCCTATCAAGGATGAGTATGAGTTTAAGGATTGGT
TTCATGCCTCGATCCCCTGCTTTTATTCCAAAAATTTTGCATAAAAGTGT
TTACCAATTGAAAAACAAAATCAAGATGTGCTCAGTGACACAACCATGCC
AATCTGATCCCAGGTGGAAGGGGTTGAACTGAAGCCCCCATCTAAACTGA
TACAGCTAGGAAAGAGCTTCTCAACTTAGAAAAAGAAGAGTTTGGCTTAT
AGCAACATGGACTCCGGATTCTCAATGTATCCTTTGAATGCTTTCAACCA
TTCAGCACCAATCGCACCATCTATTACGCGATGATCACAACTTAATGTTA
CCGACATGAAGGAAGAAAATTTGTACTGATCTGGACCCAAGCCAGGGACA
ACCCTTTTCTCAGCAGATCCAACTGCAAGAATGCCAGATTGAGGAGGATT
GATAATGGCACAGAATTGCTTGATGCCGAAGGGTCCTCCCAAATTGGTAA
CTGTGAATGTGCCTCCCTCATAATCTTGTGGTTTCAAGCTGTTGTCTTTG
GCTTTCTGGGCCAACTGTCTGACCTCTTCAGCAATTGTGGATAAGCCTTT
CTTGTCAGCATCCCTTATAACTGGGACATAAAGACCGTTTTCTGTCTGCA
CTGCTACATTAATATTCACATTCTTAAATTGTCGGATATATTCATCAGCC
CATGAACTATTG
back to top