DT214593

Overview
NameDT214593
Unique NameDT214593
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length260
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6710 contig Csv1_Contig6710:39..298. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PIN3A_ORYSJ (Probable auxin efflux carrier component 3a OS=Oryza sativa subsp. japonica GN=PIN3A PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.478e-22
Identity = 51/57 (89.47%), Postives = 55/57 (96.49%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILS+ VIFGMLI LPIT++YYI+LGL
Sbjct:  562 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSTAVIFGMLIALPITLLYYILLGL 618          
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PIN1_ORYSJ (Auxin efflux carrier component 1 OS=Oryza sativa subsp. japonica GN=PIN1 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 5.617e-22
Identity = 50/57 (87.72%), Postives = 55/57 (96.49%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            GTLLHVAIVQAALPQGIVPFVFAKEY+VHP+ILS+ VIFGMLI LPIT+VYYI+LGL
Sbjct:  539 GTLLHVAIVQAALPQGIVPFVFAKEYSVHPSILSTAVIFGMLIALPITLVYYILLGL 595          
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PIN1C_ORYSJ (Probable auxin efflux carrier component 1c OS=Oryza sativa subsp. japonica GN=PIN1C PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.251e-21
Identity = 50/57 (87.72%), Postives = 54/57 (94.74%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            GTLLHVAIVQAALPQGIVPFVFAKEY+VHP ILS+ VIFGMLI LPIT+VYYI+LGL
Sbjct:  536 GTLLHVAIVQAALPQGIVPFVFAKEYSVHPDILSTAVIFGMLIALPITLVYYILLGL 592          
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PIN1B_ORYSJ (Probable auxin efflux carrier component 1b OS=Oryza sativa subsp. japonica GN=PIN1B PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.634e-21
Identity = 49/57 (85.96%), Postives = 53/57 (92.98%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            G LLH+AIVQAALPQGIVPFVFAKEYNVHP ILS+ VIFGMLI LPIT+VYYI+LGL
Sbjct:  498 GVLLHIAIVQAALPQGIVPFVFAKEYNVHPNILSTAVIFGMLIALPITLVYYILLGL 554          
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PINI_ARATH (Auxin efflux carrier component 1 OS=Arabidopsis thaliana GN=PIN1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.641e-21
Identity = 48/57 (84.21%), Postives = 53/57 (92.98%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            G LLHVAI+QAALPQGIVPFVFAKEYNVHP ILS+ VIFGMLI LPIT++YYI+LGL
Sbjct:  566 GVLLHVAIIQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITLLYYILLGL 622          
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PIN2_ARATH (Auxin efflux carrier component 2 OS=Arabidopsis thaliana GN=PIN2 PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 4.755e-21
Identity = 46/57 (80.70%), Postives = 53/57 (92.98%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            G LLH+AIVQAALPQGIVPFVFAKEYNVHP ILS+ VIFGML+ LP+TV+YY++LGL
Sbjct:  591 GDLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPVTVLYYVLLGL 647          
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PIN7_ARATH (Auxin efflux carrier component 7 OS=Arabidopsis thaliana GN=PIN7 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 6.211e-21
Identity = 50/57 (87.72%), Postives = 53/57 (92.98%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            G LL VAIVQAALPQGIVPFVFAKEYNVHPAILS+ VIFGMLI LPIT+VYYI+LGL
Sbjct:  563 GDLLRVAIVQAALPQGIVPFVFAKEYNVHPAILSTGVIFGMLIALPITLVYYILLGL 619          
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PIN3_ARATH (Auxin efflux carrier component 3 OS=Arabidopsis thaliana GN=PIN3 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 6.211e-21
Identity = 50/57 (87.72%), Postives = 53/57 (92.98%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            G LL VAIVQAALPQGIVPFVFAKEYNVHPAILS+ VIFGMLI LPIT+VYYI+LGL
Sbjct:  584 GDLLRVAIVQAALPQGIVPFVFAKEYNVHPAILSTGVIFGMLIALPITLVYYILLGL 640          
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PIN2_ORYSJ (Probable auxin efflux carrier component 2 OS=Oryza sativa subsp. japonica GN=PIN2 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.059e-20
Identity = 46/57 (80.70%), Postives = 52/57 (91.23%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            G LLHVAIVQAALPQGIVPFVFAKEYN HP ILS+ VIFGMLI LPIT++YY++LG+
Sbjct:  574 GVLLHVAIVQAALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILYYVLLGI 630          
BLAST of DT214593 vs. ExPASy Swiss-Prot
Match: PIN4_ARATH (Auxin efflux carrier component 4 OS=Arabidopsis thaliana GN=PIN4 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.360e-20
Identity = 48/57 (84.21%), Postives = 52/57 (91.23%), Query Frame = -1
Query:   90 GTLLHVAIVQAALPQGIVPFVFAKEYNVHPAILSSVVIFGMLITLPITVVYYIVLGL 260
            G LL +AIVQAALPQGIVPFVFAKEYNVHP ILS+ VIFGMLI LPIT+VYYI+LGL
Sbjct:  560 GDLLRIAIVQAALPQGIVPFVFAKEYNVHPTILSTGVIFGMLIALPITLVYYILLGL 616          
The following BLAST results are available for this feature:
BLAST of DT214593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
PIN3A_ORYSJ1.478e-2289.47Probable auxin efflux carrier component 3a OS=Oryz... [more]
PIN1_ORYSJ5.617e-2287.72Auxin efflux carrier component 1 OS=Oryza sativa s... [more]
PIN1C_ORYSJ1.251e-2187.72Probable auxin efflux carrier component 1c OS=Oryz... [more]
PIN1B_ORYSJ1.634e-2185.96Probable auxin efflux carrier component 1b OS=Oryz... [more]
PINI_ARATH3.641e-2184.21Auxin efflux carrier component 1 OS=Arabidopsis th... [more]
PIN2_ARATH4.755e-2180.70Auxin efflux carrier component 2 OS=Arabidopsis th... [more]
PIN7_ARATH6.211e-2187.72Auxin efflux carrier component 7 OS=Arabidopsis th... [more]
PIN3_ARATH6.211e-2187.72Auxin efflux carrier component 3 OS=Arabidopsis th... [more]
PIN2_ORYSJ1.059e-2080.70Probable auxin efflux carrier component 2 OS=Oryza... [more]
PIN4_ARATH2.360e-2084.21Auxin efflux carrier component 4 OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_04I18_f2 Parent Washington Navel Orange Red Scale-Infested Rind cDNA Library UCRCS11-2 Citrus sinensis cDNA clone CS_WEd0004b_E09_VN, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214593 ID=DT214593|Name=DT214593|organism=Citrus sinensis|type=EST|length=260bp
AGCACACAAATGCTCCAAAGTGTGAAACGCCATGAAAATTCCTTGAAAAT
TCCTTGTATTCTAGCTATAATCATCGAAAATTAAATTCACAATCCGAGAA
CAATGTAGTAGACTACAGTAATTGGTAAGGTTATCAACATTCCAAAGATA
ACCACACTGCTAAGAATTGCTGGATGAACATTATACTCTTTAGCAAACAC
AAATGGAACAATTCCTTGAGGAAGTGCAGCCTGTACAATTGCGACGTGGA
GGAGGGTACC
back to top