DT214592

Overview
NameDT214592
Unique NameDT214592
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length726
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig619 contig Csv1_Contig619:689..1412. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAOX_VITVI (NADP-dependent malic enzyme OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 4.544e-55
Identity = 108/158 (68.35%), Postives = 120/158 (75.95%), Query Frame = -1
Query:  253 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSYR 726
            AS NEKP+I ALSNPTSQ ECTAEEAYTW++G+AIFASGSPFDPVEYNGK FVPGQ NNAYIFP     L+ISGAI V DEM          QVTQE+FDKGLIYPPF+NIR             AY+LGLA+R P P++LV YAESCMYSP+YRSYR
Sbjct:  434 ASCNEKPLILALSNPTSQSECTAEEAYTWTQGRAIFASGSPFDPVEYNGKTFVPGQANNAYIFPGLGMGLVISGAIRVHDEMLLAASEALARQVTQENFDKGLIYPPFSNIRKISAHIAANVAAKAYELGLATRLPQPENLVKYAESCMYSPVYRSYR 591          
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAOX_PHAVU (NADP-dependent malic enzyme OS=Phaseolus vulgaris GN=ME1 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 4.544e-55
Identity = 111/158 (70.25%), Postives = 119/158 (75.32%), Query Frame = -1
Query:  253 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSYR 726
            AS NEKP+I ALSNPTSQ ECTAEEAYTWSKG+AIFASGSPFDPVEY GK+FVPGQ NNAYIFP     LI+SGAI VRDEM         AQV++E++DKGLIYPPFTNIR             AYDLGLAS    PKDLV YAESCMYSP YRSYR
Sbjct:  432 ASLNEKPLILALSNPTSQSECTAEEAYTWSKGRAIFASGSPFDPVEYEGKLFVPGQANNAYIFPGFGLGLIMSGAIRVRDEMLLAASEALAAQVSEENYDKGLIYPPFTNIRKISANIAAKVAAKAYDLGLASHLKRPKDLVKYAESCMYSPGYRSYR 589          
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAOC_FLAPR (NADP-dependent malic enzyme, chloroplastic OS=Flaveria pringlei GN=MODA PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.255e-54
Identity = 107/158 (67.72%), Postives = 118/158 (74.68%), Query Frame = -1
Query:  253 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSYR 726
            +SFNEKP+I ALSNPTSQ ECTAE+AYTWS+G+ IFASGSPF PVEYNGKV+V GQ NNAYIFP     LIISGAI V DEM          QVTQEHFD GLIYPPFTNIR             AY+LGLASR P P++LV+YAESCMYSP YR+YR
Sbjct:  490 SSFNEKPIILALSNPTSQSECTAEQAYTWSEGRTIFASGSPFAPVEYNGKVYVSGQSNNAYIFPGFGLGLIISGAIRVHDEMLLAASEALAEQVTQEHFDNGLIYPPFTNIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCMYSPKYRNYR 647          
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAOC_FLATR (NADP-dependent malic enzyme, chloroplastic OS=Flaveria trinervia GN=MOD1 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 9.475e-53
Identity = 104/158 (65.82%), Postives = 118/158 (74.68%), Query Frame = -1
Query:  253 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSYR 726
            +S NEKP+I ALSNPTSQ ECTAE+AYTWS+G+AIFASGSPF PVEYNGK++V GQ NNAYIFP     LIISGAI V D+M          QVTQEHFDKGLI+PPFT+IR             AY+LGLASR P P++LV+YAESCMYSP YR YR
Sbjct:  491 SSLNEKPIILALSNPTSQSECTAEQAYTWSEGRAIFASGSPFKPVEYNGKLYVSGQANNAYIFPGFGLGLIISGAIRVHDDMLLAASEAPAEQVTQEHFDKGLIFPPFTSIRKISAHIAAKVAAKAYELGLASRLPQPENLVAYAESCMYSPKYRIYR 648          
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAOC_ORYSJ (NADP-dependent malic enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=ME6 PE=2 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 4.702e-52
Identity = 98/158 (62.03%), Postives = 117/158 (74.05%), Query Frame = -1
Query:  253 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSYR 726
            ASFNE+PVIF+LSNPTS  ECTAEEAY WS+G+A+FASGSPFDPVEYNGK+ VPGQ NNAYIFP     ++ISGA+ V ++M          Q TQE+F+KG I+PPFTNIR             AY+LGLA+R P P+DL  YAESCMY+P+YRSYR
Sbjct:  482 ASFNERPVIFSLSNPTSHSECTAEEAYNWSQGRAVFASGSPFDPVEYNGKIHVPGQSNNAYIFPGFGLGVVISGAVRVHEDMLLAASETLADQATQENFEKGSIFPPFTNIRKISARIAASVAAKAYELGLATRLPQPRDLEKYAESCMYTPVYRSYR 639          
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAOX_POPTR (NADP-dependent malic enzyme OS=Populus trichocarpa PE=2 SV=3)

HSP 1 Score: 199.904 bits (507), Expect = 1.158e-50
Identity = 100/158 (63.29%), Postives = 115/158 (72.78%), Query Frame = -1
Query:  253 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSYR 726
            ASFNEKP+I ALSNPTSQ ECTA+EAYTW+KG+AIFASGSPFDPVEY GKVFVPGQ NNAYIFP     L+ISGAI V D+M          Q+ +E+  KGLIYPP +NIR             AY+LGLA+R P P++LV +AESCMYSP YR YR
Sbjct:  434 ASFNEKPLILALSNPTSQSECTAQEAYTWTKGKAIFASGSPFDPVEYEGKVFVPGQSNNAYIFPGLGLGLVISGAIRVHDDMLLAAAEALAGQIKEEYLAKGLIYPPLSNIRKISVQIAANVAAKAYELGLATRLPRPENLVKHAESCMYSPAYRYYR 591          
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAOC_SOLLC (NADP-dependent malic enzyme, chloroplastic (Fragment) OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.401e-50
Identity = 102/158 (64.56%), Postives = 117/158 (74.05%), Query Frame = -1
Query:  253 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSYR 726
            A+FNEKP+IFALSNPTSQ ECTAEEAY+WS+G+AIFASGSPF PVEYNGKV+  GQ NNAYIFP     LIISGAI V D+M          +V+QE+F+KG   PPF+NIR             AY+LGLA+R P PKDLV+YAESCMYSP YRSYR
Sbjct:  417 ATFNEKPIIFALSNPTSQSECTAEEAYSWSEGRAIFASGSPFAPVEYNGKVYASGQANNAYIFPGFGLGLIISGAIRVHDDMLLVASEALADEVSQENFEKGTHIPPFSNIR-KISAHIAKVAAKAYELGLATRLPQPKDLVAYAESCMYSPAYRSYR 573          
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAOX_MESCR (NADP-dependent malic enzyme OS=Mesembryanthemum crystallinum GN=MOD1 PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.281e-49
Identity = 100/158 (63.29%), Postives = 112/158 (70.89%), Query Frame = -1
Query:  253 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSYR 726
            A+ N KP+I ALSNPTSQ ECTAEEAYTWS+G AIFASGSPFDPVEY G+ FVPGQ NNAYIFP     LI+ GAI V D+M         +QVT EHF KGLIYPPF +IR             AY+LGLASR P P DLV +AESCMY+P YRS+R
Sbjct:  428 ANINAKPLILALSNPTSQSECTAEEAYTWSQGHAIFASGSPFDPVEYEGRTFVPGQANNAYIFPGFGLGLIMCGAIRVHDDMLLAASEALASQVTGEHFIKGLIYPPFKDIRKISAHIAAGVAAKAYELGLASRLPQPADLVKFAESCMYNPTYRSFR 585          
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAOC_MAIZE (NADP-dependent malic enzyme, chloroplastic OS=Zea mays GN=MOD1 PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.853e-49
Identity = 93/158 (58.86%), Postives = 116/158 (73.42%), Query Frame = -1
Query:  253 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEYNGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSYR 726
            +SFNE+P+IF+LSNPTS  ECTAE+AYTWS+G++IFASGSPF PVEY GK FVPGQ NNAYIFP     L+ISGA+ V ++M          Q TQ++F+KG I+PPFT+IR             AY+LGLA+R P P DLV YAE+CMY+P+YR+YR
Sbjct:  479 SSFNERPIIFSLSNPTSHSECTAEQAYTWSQGRSIFASGSPFAPVEYEGKTFVPGQSNNAYIFPGLGLGLVISGAVRVHEDMLLAASKALADQATQDNFEKGSIFPPFTSIRKISAHIAAAVAGKAYELGLATRLPPPSDLVKYAENCMYTPVYRNYR 636          
BLAST of DT214592 vs. ExPASy Swiss-Prot
Match: MAON_HUMAN (NADP-dependent malic enzyme, mitochondrial OS=Homo sapiens GN=ME3 PE=2 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 7.805e-31
Identity = 69/158 (43.67%), Postives = 96/158 (60.76%), Query Frame = -1
Query:  256 ASFNEKPVIFALSNPTSQFECTAEEAYTWSKGQAIFASGSPFDPVEY-NGKVFVPGQGNNAYIFPXXXXXLIISGAICVRDEMXXXXXXXXXAQVTQEHFDKGLIYPPFTNIRXXXXXXXXXXXXXAYDLGLASRFPCPKDLVSYAESCMYSPMYRSY 726
            ASF+E+P+IFALSNPTS+ ECTAE+ Y  ++G+ IFASGSPF  V   +GK F+PGQGNNAY+FP     +I  G   + DE+          +V+++H  +G +YPP + IR             AY   LAS +P PKD  ++  S +Y+P Y S+
Sbjct:  430 ASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSF 587          
The following BLAST results are available for this feature:
BLAST of DT214592 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
MAOX_VITVI4.544e-5568.35NADP-dependent malic enzyme OS=Vitis vinifera PE=2... [more]
MAOX_PHAVU4.544e-5570.25NADP-dependent malic enzyme OS=Phaseolus vulgaris ... [more]
MAOC_FLAPR2.255e-5467.72NADP-dependent malic enzyme, chloroplastic OS=Flav... [more]
MAOC_FLATR9.475e-5365.82NADP-dependent malic enzyme, chloroplastic OS=Flav... [more]
MAOC_ORYSJ4.702e-5262.03NADP-dependent malic enzyme, chloroplastic OS=Oryz... [more]
MAOX_POPTR1.158e-5063.29NADP-dependent malic enzyme OS=Populus trichocarpa... [more]
MAOC_SOLLC4.401e-5064.56NADP-dependent malic enzyme, chloroplastic (Fragme... [more]
MAOX_MESCR1.281e-4963.29NADP-dependent malic enzyme OS=Mesembryanthemum cr... [more]
MAOC_MAIZE2.853e-4958.86NADP-dependent malic enzyme, chloroplastic OS=Zea ... [more]
MAON_HUMAN7.805e-3143.67NADP-dependent malic enzyme, mitochondrial OS=Homo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_04H04_f2 Parent Washington Navel Orange Red Scale-Infested Rind cDNA Library UCRCS11-2 Citrus sinensis cDNA clone CS_WEd0004d_D02_VN, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214592 ID=DT214592|Name=DT214592|organism=Citrus sinensis|type=EST|length=726bp
TTTATTTCTGCTGAAACTAGGAAAGTTGGTATCATTTTCAATCAATAAAG
GAACAAAAAGAAAAAGGAGGTTCCTGATAGCAATGCTAAGAACCTCTACA
TGATTAAAACAAACCAAAATAGAAAACTAAATTTAAACTGATAAACAGGC
GACAAAGAAATATTAAAAAGAACAAAAATTAATATAACTAGGTTCGCAGC
AAATTGCAAAATGCAAACTATAATCGCACACTTCCACATGGAGTTCAGTT
CAACGGTAGCTTCGGTACATTGGGCTGTACATGCAGCTCTCAGCGTAACT
CACTAAATCCTTAGGACAAGGAAAACGGGAAGCCAGACCAAGGTCATATG
CCTTGGCAGCAACTTTAGCAGCAATGTGGGCAGAGATCTTTCTGATATTA
GTGAAGGGGGGGTATATCAATCCCTTATCGAAGTGCTCTTGTGTCACTTG
CGCTGCCAAAGCTTCCGAGGCTGCTAGAAGCATCTCATCGCGGACACAAA
TTGCACCGGATATTATCAAACCCAGACCCAATCCGGGGAATATATAAGCA
TTGTTTCCCTGGCCAGGCACAAAAACTTTCCCATTGTATTCAACAGGGTC
AAATGGGCTTCCACTAGCAAAGATTGCTTGACCCTTACTCCATGTATAAG
CTTCTTCCGCTGTACACTCAAACTGTGAGGTAGGATTGGATAGAGCAAAA
ATAACGGGTTTCTCATTAAAGGATGC
back to top