DT214588

Overview
NameDT214588
Unique NameDT214588
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length875
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: C75A5_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A5 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 3.267e-56
Identity = 109/222 (49.10%), Postives = 153/222 (68.92%), Query Frame = -1
Query:  105 KLDRHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLH-GAPMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFLGK---SIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLY 758
            +L   ++K   L++    T+TS+ ++EWA AEL+KNP IL +A+EE+D VIG++R F E DI  LP+++AI KE  R H   P+ +PR+A + C+V G+ I KGT++ VN W I RDP+LWENPNEF P+RFL +    ID +GNDFEL+PFGAGRR+C G   G+ +++  L  L+H F W+LP ++   ELNM+E F LA QK +PL  +  PRL  H+Y
Sbjct:  289 RLHTVNIKALLLNMFTAGTDTSSSVIEWALAELLKNPIILKRAQEEMDGVIGRDRRFLEADISKLPYLQAICKEAFRKHPSTPLNLPRIASQACEVNGHYIPKGTRLSVNIWAIGRDPSLWENPNEFNPDRFLERKNAKIDPRGNDFELIPFGAGRRICAGTRLGILLVEYILGTLVHSFDWELPSSVI--ELNMDEPFGLALQKAVPLAAMVTPRLPLHIY 508          
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 4.266e-56
Identity = 99/198 (50.00%), Postives = 142/198 (71.72%), Query Frame = -1
Query:  174 EVKLDRHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLH-GAPMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFLGKSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVF 764
            E +LD + ++   LD+    T+TS+  LEWA AEL++NP+ + KA+ E+DRV+G+    +E DI  LP+++A++KET RLH  AP+L+PR A  D +V G+ + K TQVLVN W I RDP++WENP++F PERF+GK IDVKG D+EL PFG GRR+CPG    +K +   LA+LL+ F WKLP  + +++L+M+E F
Sbjct:  293 EAELDNNDIEHLLLDMFTAGTDTSSSTLEWAMAELLRNPKTMVKAQAEMDRVLGQNSVVQESDISGLPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVLVNVWAIGRDPSVWENPSQFEPERFMGKDIDVKGRDYELTPFGGGRRICPGLPLAVKTVSLMLASLLYSFDWKLPNGVVSEDLDMDETF 490          
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: C75A7_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A7 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 4.266e-56
Identity = 108/223 (48.43%), Postives = 154/223 (69.06%), Query Frame = -1
Query:  102 KLDRHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLH-GAPMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFLGK---SIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLYN 758
            +L   ++K   L++    T+TS+ ++EWA AEL+KNP IL +A+EE+D VIG++R F E DI  LP+++AI KE  R H   P+ +PR+A + C+V G+ I KGT++ VN W I RDP++WENPNEF P+RFL +    ID +GNDFEL+PFGAGRR+C G   G+ +++  L  L+H F W+LP ++   ELNM+E F LA QK +PL  +  PRL  H+Y+
Sbjct:  289 RLQTVNIKALLLNMFTAGTDTSSSVIEWALAELLKNPIILRRAQEEMDGVIGRDRRFLEADISKLPYLQAICKEAFRKHPSTPLNLPRIASQACEVNGHYIPKGTRLSVNIWAIGRDPSVWENPNEFNPDRFLERKNAKIDPRGNDFELIPFGAGRRICAGTRLGILLVEYILGTLVHSFVWELPSSVI--ELNMDESFGLALQKAVPLAAMVTPRLPLHIYS 509          
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 1.241e-55
Identity = 107/225 (47.56%), Postives = 150/225 (66.67%), Query Frame = -1
Query:   99 VKLDRHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLH-GAPMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFLGK---SIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLYNV 761
            ++L+  +VK   LDL    T+TS+ ++EWA AE++ + +IL++A EE+D+VIG+ R  E+ DI NLP+ +AI KET R H   P+ +PR++ E C+V G+ I K T+++VN W I RDP +WENP +F PERFL +    ID +GN FEL+PFGAGRR+C G   G   ++  L  L+H F WKLP  +   E+NMEE F +A QKK+PL  +  PRL P  Y V
Sbjct:  301 IQLNLVNVKALLLDLFTAGTDTSSSVIEWALAEMLNHRQILNRAHEEMDQVIGRNRRLEQSDIPNLPYFQAICKETFRKHPSTPLNLPRISTEACEVDGFHIPKNTRLIVNIWAIGRDPKVWENPLDFTPERFLSEKHAKIDPRGNHFELIPFGAGRRICAGARMGAASVEYILGTLVHSFDWKLPDGV--VEVNMEESFGIALQKKVPLSAIVTPRLPPSSYTV 523          
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: C75A1_PETHY (Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 1.241e-55
Identity = 111/222 (50.00%), Postives = 145/222 (65.32%), Query Frame = -1
Query:  105 KLDRHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLH-GAPMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFL---GKSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLY 758
            +L   ++K   L+L    T+TS+  +EWA AE++KNP IL KA+ E+D+VIG+ R   E DI NLP++ AI KET R H   P+ +PR++ E C V GY I K T++ VN W I RDP +WENP EF PERFL      ID +GNDFEL+PFGAGRR+C G   G+ +++  L  L+H F WKLP  +   ELNMEE F LA QK +PLE +  PRL   +Y
Sbjct:  285 RLSTTNIKALLLNLFTAGTDTSSSAIEWALAEMMKNPAILKKAQAEMDQVIGRNRRLLESDIPNLPYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPQVWENPLEFNPERFLSGRNSKIDPRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWKLPSEVI--ELNMEEAFGLALQKAVPLEAMVTPRLQLDVY 504          
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.621e-55
Identity = 102/211 (48.34%), Postives = 144/211 (68.25%), Query Frame = -1
Query:  135 EVKLDRHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLHG-APMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFLGKSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVV 764
            E +L    ++   LD+    T+TS+  LEWA  EL+KNP+ + KA+ E+D VIG+    EE DI  LP+++A++KET RLH   P+L+PR A  D ++ G+ +LK TQVLVN W I RDP++W+NP++F PERFLGK +DV+G D+EL PFGAGRR+CPG    +K +   LA+LL+ F WKLP  + +++L+M+E F L   K  PL  V
Sbjct:  293 ESELSISDIEHLLLDMFTAGTDTSSSTLEWAMTELLKNPKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAESDAEILGFMVLKDTQVLVNVWAIGRDPSVWDNPSQFEPERFLGKDMDVRGRDYELTPFGAGRRICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSEDLDMDETFGLTLHKTNPLHAV 503          
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: C75A3_PETHY (Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.117e-55
Identity = 111/222 (50.00%), Postives = 144/222 (64.86%), Query Frame = -1
Query:  105 KLDRHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLH-GAPMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFL---GKSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLY 758
            +L   ++K   L+L    T+TS+  +EWA AE++KNP IL KA+ E+D+VIG  R   E DI NLP++ AI KET R H   P+ +PR++ E C V GY I K T++ VN W I RDP +WENP EF PERFL      ID +GNDFEL+PFGAGRR+C G   G+ +++  L  L+H F WKLP  +   ELNMEE F LA QK +PLE +  PRL   +Y
Sbjct:  285 RLSTTNIKALLLNLFTAGTDTSSSAIEWALAEMMKNPAILKKAQGEMDQVIGNNRRLLESDIPNLPYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPEVWENPLEFYPERFLSGRNSKIDPRGNDFELIPFGAGRRICAGTRMGIVMVEYILGTLVHSFDWKLPSEVI--ELNMEEAFGLALQKAVPLEAMVTPRLPIDVY 504          
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: C98A2_SOYBN (Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.612e-55
Identity = 104/225 (46.22%), Postives = 144/225 (64.00%), Query Frame = -1
Query:  105 TLEVKLD--RHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLHG-APMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFLGKSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLY 770
            TL+ K D    ++ G   D+I    +T+ + +EWA AEL++NP +  K +EELDRVIG ER   E D  NLP+++ + KE MRLH   P+++P  A  + KV GYDI KG+ V VN W + RDPA+W++P EF PERFL + +D+KG+DF LLPFG+GRR+CPG   G+ +  S L +LLH F W  P  M  +E++M E   L    + P++ V  PRL  HLY
Sbjct:  278 TLQDKYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIRNPRVQQKVQEELDRVIGLERVMTEADFSNLPYLQCVTKEAMRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAVWKDPLEFRPERFLEEDVDMKGHDFRLLPFGSGRRVCPGAQLGINLAASMLGHLLHHFCWTPPEGMKPEEIDMGENPGLVTYMRTPIQAVVSPRLPSHLY 502          
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 6.160e-55
Identity = 103/219 (47.03%), Postives = 148/219 (67.58%), Query Frame = -1
Query:   99 VKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLHG-APMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFLG----KSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVVAQPRLAPHLYNV 740
            +K   L++    T+TS   ++WA AEL+++P+I+ KA+EELD V+G++R   E DI  LP+++A+IKE  RLH   P+ +P +A E C++ GY I KG+ +L N W I RDP  W +P  F PERFL       +DVKG+DFEL+PFGAGRR+C G S GL+ IQ   A L+ GF W+L G ++ ++LNMEE + L  Q+ +PL V  +PRLAP++Y +
Sbjct:  292 IKALLLNMFTAGTDTSASTVDWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGGVTPEKLNMEESYGLTLQRAVPLVVHPKPRLAPNVYGL 510          
BLAST of DT214588 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 8.046e-55
Identity = 101/220 (45.91%), Postives = 145/220 (65.91%), Query Frame = -1
Query:  102 LDRHSVKGFTLDLIAGATETSTLMLEWAFAELVKNPEILDKAREELDRVIGKERWFEEKDIVNLPFIEAIIKETMRLHG-APMLMPRMAREDCKVAGYDILKGTQVLVNTWTIERDPALWENPNEFCPERFLGKSIDVKGNDFELLPFGAGRRMCPGYSNGLKVIQSSLANLLHGFTWKLPGNMSNKELNMEEVFKLANQKKIPLEVVAQPRL-APHLYN 755
            L   +V G   D+I    +T+ + +EWA AELV+NP +  K +EELDRV+G++R   E D  NLP+++A++KE++RLH   P+++P  A  + K+ GYDI KG  V+VN W + RDP +W NP E+ PERFL ++ID+KG+DF +LPFGAGRR+CPG   G+ ++ S + +LLH F W LP     +++NM E   L      PL+ VA+PRL    LYN
Sbjct:  287 LSEDTVIGLLWDMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVMLETDFQNLPYLQAVVKESLRLHPPTPLMLPHKASTNVKIGGYDIPKGANVMVNVWAVARDPKVWSNPLEYRPERFLEENIDIKGSDFRVLPFGAGRRVCPGAQLGINLVASMIGHLLHHFEWSLPEGTRPEDVNMMESPGLVTFMGTPLQAVAKPRLEKEELYN 506          
The following BLAST results are available for this feature:
BLAST of DT214588 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
C75A5_EUSGR3.267e-5649.10Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C76C4_ARATH4.266e-5650.00Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
C75A7_EUSGR4.266e-5648.43Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C75A6_CAMME1.241e-5547.56Flavonoid 3',5'-hydroxylase OS=Campanula medium GN... [more]
C75A1_PETHY1.241e-5550.00Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida G... [more]
C76C1_ARATH1.621e-5548.34Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C75A3_PETHY2.117e-5550.00Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida G... [more]
C98A2_SOYBN3.612e-5546.22Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=... [more]
F3PH_ARATH6.160e-5547.03Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C98A1_SORBI8.046e-5545.91Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_03F04_f2 Parent Washington Navel Orange Red Scale-Infested Rind cDNA Library UCRCS11-2 Citrus sinensis cDNA clone CS_WEd0003d_C02_VN, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214588 ID=DT214588|Name=DT214588|organism=Citrus sinensis|type=EST|length=875bp
AGCTCAATTTTCACCAAAATGGATTATGAAATTATTACTTACGATAAGTT
TATTATTTTGGAAGCCATGTAAATTTATTATTTTGGCATCCACAATCACA
CATTGTAAAGATGGGGAGCAAGTCTTGGCTGAGCTACAACTTCAAGTGGA
ATTTTTTTCTGATTAGCAAGCTTAAAAACTTCCTCCATATTAAGCTCCTT
ATTGCTCATATTCCCAGGCAATTTCCATGTAAATCCATGCAAAAGATTAG
CCAGGCTTGATTGAATCACCTTCAGCCCATTACTGTAACCTGGACACATT
CTTCTCCCCGCTCCAAATGGCAGTAACTCAAAATCATTTCCTTTGACATC
AATTGATTTTCCAAGAAACCTCTCAGGGCAAAACTCATTGGGGTTTTCCC
ACAGAGCGGGGTCTCTCTCTATTGTCCACGTATTAACTAGTACTTGAGTG
CCTTTCAAGATGTCGTAGCCCGCAACTTTGCAATCTTCTCTAGCCATCCT
GGGCATAAGCATTGGAGCACCGTGCAAACGCATTGTTTCTTTAATTATGG
CCTCAATAAATGGGAGATTAACAATGTCTTTCTCTTCAAACCACCTTTCT
TTTCCAATTACTCTGTCTAGTTCTTCTCTTGCTTTATCTAAAATTTCCGG
ATTTTTCACTAATTCAGCGAAGGCCCATTCCAACATCAATGTTGAGGTCT
CAGTCGCTCCAGCTATTAGGTCCAATGTAAAACCTTTGACGCTGTGTCTG
TCCAGCTTAACTTCGAGAGTAGGATCATCAGCAAGCAGCAAAAGCACATC
CACCATATCTTTAGCCACATAATTATCGATCCCTTTTCGTCTAGCATTAT
GTTCATCAACCACCTGCTCTAAAAA
back to top