DT214587

Overview
NameDT214587
Unique NameDT214587
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length907
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5823 contig Csv1_Contig5823:1497..2403. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: CID11_SCHPO (Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe GN=cid11 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 7.729e-40
Identity = 91/239 (38.08%), Postives = 142/239 (59.41%), Query Frame = -3
Query:  198 ILQSDNLQNVQALTRARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGV-NVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQGMEKTYSVTVDDIECAYFDQVDKLHGFGSR---NKESIGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQEKDWTRRIGNDRHLICIEDPFEVTHDLGRVVDKFSIKVLREEFERAAEIMQHDPNPCVKL 902
            +L S  ++ +  ++RARVPIVK+ DP   I CD+ INN +A +NTK+LR +  ID R++ L  I+K+WAK R + +    GT++SY    M ++FLQ R P ILP +  +     ++ DD +      VD + GF  +   NK S+GRL+  FF Y+ +  +Y  +V+SVR+G+ ++KQEK W   + N    +C+E+PF    +L    D  S+K L+ EF+RA  +M  + N C +L
Sbjct:  128 LLYSYGMKQIVCVSRARVPIVKIWDPQFDIHCDLNINNDVAKINTKMLRLFVSIDPRVRPLGLIIKYWAKQRALCDAAGSGTITSYTISCMLVNFLQTRNPPILPAMLDL-----MSNDDNKMF----VDDIVGFKEKATLNKTSLGRLLIDFFYYYGFSFNYLDSVVSVRSGTVLNKQEKGWAMEVNNS---LCVEEPFNTARNLANTADNPSVKGLQSEFQRAFRLMSEN-NACERL 353          
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: CID13_SCHPO (Poly(A) RNA polymerase cid13 OS=Schizosaccharomyces pombe GN=cid13 PE=1 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.318e-39
Identity = 84/229 (36.68%), Postives = 139/229 (60.70%), Query Frame = -3
Query:  213 DNLQNVQALTRARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQG-TLSSYAYVLMCIHFLQQRRPAILPCLQGME--KTYSVTVDDIECAYFDQVDKLHGFGSRNKESIGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQEKDWTRRIGNDRHLICIEDPFEVTHDLGRVVDKFSIKVLREEFERAAEIMQHDPN 890
            + L+ V  ++ A+VPIVK+ D    +SCD  IN  ++ +NT+L+R Y   D R++ L  ++K+WAK R +N   +G TL+SY    M I+FLQ+R P ILP LQ +   +  S   D ++ ++FD  D +HGFG +N+ES+G L   FF ++ Y  DY   V+S+R G+ +SK+ K W  ++ N    +C+E+PF  + +L    D+ ++K ++ EF R   ++ ++ N
Sbjct:  136 NGLKKVVCISTAKVPIVKVWDSELQLSCDCNINKTISTLNTRLMRSYVLCDPRVRPLIVMIKYWAKRRCLNDAAEGGTLTSYTISCMVINFLQKRDPPILPSLQMLPHLQDSSTMTDGLDVSFFDDPDLVHGFGDKNEESLGILFVEFFRFFGYLFDYEHFVLSIRHGTFLSKRAKGWQFQLNN---FLCVEEPFHTSRNLANTADEITMKGIQLEFRRVFRLLAYNCN 361          
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: CID1_SCHPO (Poly(A) RNA polymerase protein cid1 OS=Schizosaccharomyces pombe GN=cid1 PE=2 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 1.081e-33
Identity = 87/243 (35.80%), Postives = 132/243 (54.32%), Query Frame = -3
Query:  192 LTRARVPIVKLMDPV-----TGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFL-QQRRPAILPCLQGMEKTYSVTVDDIECAYFDQVDKLHGFGSRNKESIGRLVWAFFNYWAYGHDYASNVISV-RTGSTISKQEKDWTR---------RIGNDRHLICIEDPFEVTHDLGRVVDKFSIKVLREEFERAAEIM--QHDPNPCVKLFE 866
            L RAR+PI+KL             CDI  NN LA+ NT LL  Y ++D RL+ +  +VKHWAK + +N  Y GTLSSY YVLM +++L    +P + P L          VD  +  + D+++ +    S+N  S+G L+  FF ++AY  +    V++  R    ++KQEK WT          +I  DR+++ IEDPFE++H++GR V    +  +R EF  A+ ++  +  P P   LFE
Sbjct:  135 LQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIP--PSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSATEHTGSADQIIKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFE 375          
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: TUT7_HUMAN (Terminal uridylyltransferase 7 OS=Homo sapiens GN=ZCCHC6 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.726e-31
Identity = 77/203 (37.93%), Postives = 120/203 (59.11%), Query Frame = -3
Query:  294 LQNVQALTRARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQGM---EKTYSVTVDDIECAYFDQVDKLHGFGS---RNKESIGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQEKDWTRRIGNDRHLICIEDPFEVTHDLG 884
            L+N+  +T A+VPIVK     +G+  DI + N LA+ NT+LL  Y+ ID R++ L + +K + K   +    +G+LSSYAY LM ++FLQQR P ++P LQ +   EK   + VD     +FDQ+D+L  + S   +N ES+G+L      ++    D+  +VIS+R  S ++  +K WT +       I IEDPF++ H+LG
Sbjct: 1093 LRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYKGEKKPEIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSK------YIVIEDPFDLNHNLG 1289          

HSP 2 Score: 83.1889 bits (204), Expect = 2.264e-15
Identity = 62/238 (26.05%), Postives = 103/238 (43.28%), Query Frame = -3
Query:  282 SDNLQNVQALTRARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQG-------MEKTYSVTVDDIE--CAYFDQVDKLHGFGSRNKES-------------------------IGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQEKDWTRRIGNDRHLICIEDPFEVTHDLGRVVD 893
            SD+  +V A   ARVP+V   +  +G+ C +   N  A + TK L    +++ +L  L    ++WAK   ++   +G L  Y + LM I FLQQR+  +LP   G       + K  +  + DIE     ++  D   G     KE                          +G+L      ++A   + A  VIS+R    +S++ KDW ++       I IEDP+ V  ++ R ++
Sbjct:  379 SDSFIDVDADFHARVPVVVCREKQSGLLCKVSAGNENACLTTKHLTALGKLEPKLVPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAIFFLQQRKEPLLPVYLGSWIEGFSLSKLGNFNLQDIEKDVVIWEHTDSAAGDTGITKEEAPRETPIKRGQVSLILDVKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELVSRELKDWPKK------RIAIEDPYSVKRNVARTLN 610          
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: TUT7_MOUSE (Terminal uridylyltransferase 7 OS=Mus musculus GN=Zcchc6 PE=1 SV=3)

HSP 1 Score: 129.798 bits (325), Expect = 2.110e-29
Identity = 79/248 (31.85%), Postives = 131/248 (52.82%), Query Frame = -3
Query:  183 LQNVQALTRARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQGM---EKTYSVTVDDIECAYFDQVDKLHGFG---SRNKESIGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQEKDWTRRIGNDRHLICIEDPFEVTHDLGRVVDKFSIKVLREEFERAAEIM--------QHDPNPCVKLFEPYV 884
            L+N+  +T A+VPIVK     +G+  DI + N LA+ NT+LL  Y+ ID R++ L + +K + K   +    +G+LSSYAY LM ++FLQQR P ++P LQ +   EK   + VD     +FDQ+++L        +N E +G+L      ++    D+  +VIS+R  S ++  +K WT +       I IEDPF++ H+LG  + +     + + F     +         + +P+     F+P V
Sbjct: 1089 LRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRSPPVIPVLQEIYKGEKKPEILVDGWNIYFFDQINELPTCWPEYGKNTEPVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFKKQWTSK------YIVIEDPFDLNHNLGAGLSRKMTNFIMKAFINGRRVFGIPVKGFPKDNPSKLAYFFDPDV 1330          

HSP 2 Score: 86.6557 bits (213), Expect = 2.048e-16
Identity = 64/238 (26.89%), Postives = 105/238 (44.12%), Query Frame = -3
Query:  282 SDNLQNVQALTRARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQG-------MEKTYSVTVDDIE--CAYFDQVDKLHGFGSRNKES-------------------------IGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQEKDWTRRIGNDRHLICIEDPFEVTHDLGRVVD 893
            SD+  +V A   ARVP+V   D  +G+ C +   N  A + TK L    +++ RL  L    ++WAK   ++   +G L  Y + LM + FLQQR+  +LP   G       + K  + ++ D+E     ++  D   G  S  KE                          +G+L      ++A   + A  VIS+R    IS++ KDW ++       I IEDP+ V  ++ R ++
Sbjct:  379 SDSFIDVDADFHARVPVVVCRDKQSGLLCKVSAGNENAWLTTKHLTALGKLEPRLVPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAVFFLQQRKEPLLPVYLGSWIEEFSLNKLGNFSLKDVEKDSVVWEYTDNSTGDTSSAKEEAPKETAAKKGQVPLTFNIKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELISRESKDWPKK------RIAIEDPYSVKRNVARTLN 610          
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: TUT4_MOUSE (Terminal uridylyltransferase 4 OS=Mus musculus GN=Zcchc11 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 1.047e-28
Identity = 77/219 (35.16%), Postives = 121/219 (55.25%), Query Frame = -3
Query:  249 LQNVQALTRARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQGM---EKTYSVTVDDIECAYFDQVD----KLHGFGSRNKESIGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQEKDWTRRIGNDRHLICIEDPFEVTHDLGRVVDKFSIKVLREEF 884
            L+N+  +T A+VPIVK     +G+  DI + N LA  NT++L  YA ID R+Q L + +K +AK   +    +G+LSSYAY+LM ++FLQQR+P ++P LQ +   ++     VD     +FD+ +    +L   G +N ES+G L      ++    D+   VIS+R    ++  EK WT +       I IEDPF++ H+LG  V +     + + F
Sbjct: 1061 LRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDKTEELKKRLPSLG-KNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSK------CIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1272          
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: TUT4_HUMAN (Terminal uridylyltransferase 4 OS=Homo sapiens GN=ZCCHC11 PE=1 SV=3)

HSP 1 Score: 127.487 bits (319), Expect = 1.047e-28
Identity = 77/219 (35.16%), Postives = 121/219 (55.25%), Query Frame = -3
Query:  249 LQNVQALTRARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQGM---EKTYSVTVDDIECAYFDQVD----KLHGFGSRNKESIGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQEKDWTRRIGNDRHLICIEDPFEVTHDLGRVVDKFSIKVLREEF 884
            L+N+  +T A+VPIVK     +G+  DI + N LA  NT++L  YA ID R+Q L + +K +AK   +    +G+LSSYAY+LM ++FLQQR+P ++P LQ +   ++     VD     +FD+ +    +L   G +N ES+G L      ++    D+   VIS+R    ++  EK WT +       I IEDPF++ H+LG  V +     + + F
Sbjct: 1044 LRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMVDGWNAFFFDKTEELKKRLPSLG-KNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSK------CIAIEDPFDLNHNLGAGVSRKMTNFIMKAF 1255          
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: GLD2B_XENLA (Poly(A) RNA polymerase GLD2-B OS=Xenopus laevis GN=papd4-B PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.786e-28
Identity = 77/218 (35.32%), Postives = 119/218 (54.59%), Query Frame = -3
Query:  240 RARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQGMEKTYSVTVDDIECAYFDQVDKLH----------GFGSRNKESIGRLVWAFFNYWAYGHDYASNVISVRTGSTISK-QEKDWTRRIGNDRHLICIEDPFEVTHDLGRVVDKFSIKVLREEFERA 860
            RA+VPIVK  D V+G   D+ +NN++ + NT LLR YA +D R++ L  ++K WA   G+N   +GTLSSY  VLM +H+LQ     ILP LQ   K Y       EC  FD+  +LH           F S+N+  +G L+  F  Y+A   D++ ++IS+R    + +  + +W  +       IC+E+PF+ ++    V +K    ++R EF +A
Sbjct:  283 RAKVPIVKFRDKVSGAEFDLNVNNVVGIRNTFLLRTYAYLDKRVRPLVLVIKKWANHHGINDASRGTLSSYTIVLMVLHYLQTLPEPILPSLQ---KKYP------EC--FDRTMQLHLVHQAPRNIPQFLSKNETPLGDLLLGFLKYFAVEFDWSKDIISLREAKALPRTDDYEWRNK------YICVEEPFDGSNTARAVYEKQKFDLIRAEFLKA 483          
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: GLD2_DANRE (Poly(A) RNA polymerase GLD2 OS=Danio rerio GN=papd4 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 5.196e-28
Identity = 74/215 (34.42%), Postives = 112/215 (52.09%), Query Frame = -3
Query:  225 LTRARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQGMEKTYSVTVDDIECAYFDQVDKLHGFGSRNKESIGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQE-KDWTRRIGNDRHLICIEDPFEVTHDLGRVVDKFSIKVLREEFERAAEIMQ 866
            L RA+VPIVK  D ++G+  D+  NN + + NT LLR YA ++ R++ L  ++K WA    +N   +GTLSSY  VLM +H+LQ     ++PCLQ    T      DI        D +  F SRN+ S+G L   F  Y+A    +   VISVR   T+ K   K+W  +       IC+E+PF  T+    V ++   + ++  F  +  ++Q
Sbjct:  259 LIRAKVPIVKFRDRISGVEFDLNFNNTVGIRNTFLLRTYAFVEKRVRPLVLVIKKWANHHCINDASRGTLSSYTLVLMVLHYLQTLPEPVIPCLQRDYPTCFDPKMDIHLVPSGPSD-IPAFVSRNQSSLGDLFLGFLRYYATVFKWDKQVISVRMARTLPKSNCKEWKDK------FICVEEPFNRTNTARAVHERMKFEAIKAAFIESHRLLQ 466          
BLAST of DT214587 vs. ExPASy Swiss-Prot
Match: GLD2A_XENLA (Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis GN=papd4-A PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 6.786e-28
Identity = 79/224 (35.27%), Postives = 124/224 (55.36%), Query Frame = -3
Query:  219 RARVPIVKLMDPVTGISCDICINNLLAVVNTKLLRDYAQIDVRLQQLAFIVKHWAKSRGVNVTYQGTLSSYAYVLMCIHFLQQRRPAILPCLQGMEKTYSVTVDDIECAYFD---QVDKLH-------GFGSRNKESIGRLVWAFFNYWAYGHDYASNVISVRTGSTISKQEKDWTRRIGNDRHLICIEDPFEVTHDLGRVVDKFSIKVLREEFERAAEIMQHD 860
            RA+VPIVK  D V+G   D+ +NN++ + NT LLR YA ++ R++ L  ++K WA   G+N   +GTLSSY  VLM +H+LQ     ILP LQ   K Y       EC  FD   Q++ +H        + S+N+  +G L+  F  Y+A   D++ ++ISVR G  + + + D+  R       IC+E+PF+ T+    V ++    ++R EF +A   ++ D
Sbjct:  283 RAKVPIVKFRDKVSGAEFDLNVNNVVGIRNTFLLRTYAYLESRVRPLVLVIKKWANHHGINDASRGTLSSYTLVLMVLHYLQTLPEPILPSLQ---KKYP------EC--FDLSMQLNLVHHAPRNIPPYLSKNETPLGDLLLGFLKYFAVEFDWSKDIISVREGKALPRSD-DYLWR----NKYICVEEPFDGTNTARAVYERQKFDMIRAEFLKAWGALRDD 490          
The following BLAST results are available for this feature:
BLAST of DT214587 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 29
Match NameE-valueIdentityDescription
CID11_SCHPO7.729e-4038.08Poly(A) RNA polymerase cid11 OS=Schizosaccharomyce... [more]
CID13_SCHPO1.318e-3936.68Poly(A) RNA polymerase cid13 OS=Schizosaccharomyce... [more]
CID1_SCHPO1.081e-3335.80Poly(A) RNA polymerase protein cid1 OS=Schizosacch... [more]
TUT7_HUMAN1.726e-3137.93Terminal uridylyltransferase 7 OS=Homo sapiens GN=... [more]
TUT7_MOUSE2.110e-2931.85Terminal uridylyltransferase 7 OS=Mus musculus GN=... [more]
TUT4_MOUSE1.047e-2835.16Terminal uridylyltransferase 4 OS=Mus musculus GN=... [more]
TUT4_HUMAN1.047e-2835.16Terminal uridylyltransferase 4 OS=Homo sapiens GN=... [more]
GLD2B_XENLA1.786e-2835.32Poly(A) RNA polymerase GLD2-B OS=Xenopus laevis GN... [more]
GLD2_DANRE5.196e-2834.42Poly(A) RNA polymerase GLD2 OS=Danio rerio GN=papd... [more]
GLD2A_XENLA6.786e-2835.27Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_03A19_f2 Parent Washington Navel Orange Red Scale-Infested Rind cDNA Library UCRCS11-2 Citrus sinensis cDNA clone CS_WEd0003a_A10_VN, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214587 ID=DT214587|Name=DT214587|organism=Citrus sinensis|type=EST|length=907bp
ATAAAATTGCAACTGTCGGTTAAGCCAACAAGTTCTTTACACCCAAGGAT
ATTTAAATAATAAGCTGAAGCCCTAAATACAAAACTATAAAACACAAGAC
CATGGAACGGATGCTTAAGGCTGATCAATCTCTTTTCATTGCAATTACAT
CTCTAACAAGTGTGCTGCTTAAATCAACCAGGAACATAGGGTTCAAAGAG
TTTCACACATGGATTTGGATCATGCTGCATGATTTCAGCAGCACGTTCAA
ACTCCTCCCTTAGAACTTTTATGCTGAACTTGTCCACAACTCGACCAAGG
TCGTGAGTCACCTCAAAGGGATCCTCTATGCATATCAAATGACGGTCATT
TCCAATCCTTCTTGTCCAGTCCTTTTCTTGTTTGCTTATTGTACTTCCGG
TGCGAACGGAAATAACGTTGCTGGCATAATCATGACCATAAGCCCAGTAA
TTGAAAAATGCCCACACAAGTCGACCAATACTTTCCTTGTTACGAGACCC
AAATCCATGAAGTTTGTCAACTTGATCAAAGTAAGCACATTCAATATCAT
CCACAGTCACAGAGTATGTTTTCTCCATTCCCTGTAAGCATGGAAGAATA
GCAGGCCTACGCTGCTGTAAGAAATGAATGCACATCAAAACATACGCATA
GCTAGATAGGGTTCCTTGATAAGTTACATTGACTCCTCTTGATTTAGCCC
AATGTTTAACAATAAAAGCCAACTGCTGCAATCGCACATCTATTTGAGCA
TAATCCCGAAGAAGCTTTGTATTTACAACAGCCAAAAGATTGTTTATGCA
TATGTCACAAGAAATTCCAGTGACTGGATCCATAAGCTTTACTATGGGGA
CCCTTGCCCGTGTCAGTGCCTGCACATTCTGGAGATTATCTGATTGCAAG
ATATCTG
back to top