DT214585

Overview
NameDT214585
Unique NameDT214585
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length906
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1656 contig Csv1_Contig1656:741..1646. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPK9_ARATH (CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2)

HSP 1 Score: 399.823 bits (1026), Expect = 1.093e-110
Identity = 191/251 (76.10%), Postives = 223/251 (88.84%), Query Frame = -3
Query:  155 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEE-VNLDDVDAIFNDSKENLVTEKKEKPVSMNAFELISRTKSFSLENLFEKQTGLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNYKMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQAEENKEE 904
            KGYDG A DVWSCGVILFVLMAG+LPFDE NLM LY++IC+A+FSCP WFS GAK++IKRIL+PN  TR++I+++LEDEWFKKGYKPP FD+++E + +DDVDA F++SKE LVTEKKEKPVSMNAFELIS +  FSLENLFEKQ  LVK+ETRFTSQR  +EIMSK+EE AKPLGFNVRK NYK+K++GDK+GRKGQLSVATEVFEVAP+LH+VE+RKTGGDTLEFHKFYK FSSGLKDVVW  +   EE
Sbjct:  194 KGYDGAAADVWSCGVILFVLMAGYLPFDEPNLMTLYKRICKAEFSCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEWFKKGYKPPSFDQDDEDITIDDVDAAFSNSKECLVTEKKEKPVSMNAFELISSSSEFSLENLFEKQAQLVKKETRFTSQRSASEIMSKMEETAKPLGFNVRKDNYKIKMKGDKSGRKGQLSVATEVFEVAPSLHVVELRKTGGDTLEFHKFYKNFSSGLKDVVWNTDAAAEE 444          
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPK9_ORYSJ (CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 2.883e-103
Identity = 183/248 (73.79%), Postives = 212/248 (85.48%), Query Frame = -3
Query:  164 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEEVNLDDVDAIFNDSKENLVTEKKEKPVSMNAFELISRTKSFSLENLFEKQ-TGLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNYKMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQAEEN 904
            KGYDG A DVWSCG+ILFVLMAG+LPFD+ NLM LY+ IC+A  SCP WFSSGAKK IKRILDPN  TR+TI+Q+LED+WFKK YKPP F++ E+V+LDDVDA F+ S+ENLV EK+EKP SMNAF LISR++ F+L NLFEK+  G+VKRET FTSQ  P EIMSKIEEA  PLGFNVRK NYKMKL+GDKTGRKG LSVATEVFEVAP+LH+VE+RKTGGDTLEFH FY  FSS LKD+VW++E +
Sbjct:  202 KGYDGMAADVWSCGIILFVLMAGYLPFDDPNLMTLYKLICKAKVSCPHWFSSGAKKFIKRILDPNPCTRITIAQILEDDWFKKDYKPPLFEQGEDVSLDDVDAAFDCSEENLVAEKREKPESMNAFALISRSQGFNLGNLFEKEMMGMVKRETSFTSQCTPQEIMSKIEEACGPLGFNVRKQNYKMKLKGDKTGRKGYLSVATEVFEVAPSLHMVELRKTGGDTLEFHNFYNNFSSELKDIVWKSESD 449          
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPKN_ARATH (CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 6.025e-93
Identity = 167/257 (64.98%), Postives = 216/257 (84.05%), Query Frame = -3
Query:  155 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEEVNLDDVDAIFNDSKE--NLVTEKKEK----PVSMNAFELISRTKSFSLENLFEKQTGLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNYKMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQA-EENKEE 904
            KGYDG   D+WSCGVILFVLMAG+LPF++SNL +LY+KI +A+F+CP WFS+ AKKLIKRILDPN  TR+T ++++E+EWFKKGYK P F+  + V+LDDVDAIF+DS E  NLV E++E+    PV+MNAFELIS ++  +L +LFEKQ GLVKR+TRFTS+   NEI++KIE AA P+GF+V+  NYKMKL G+K+GRKGQL+VATEVF+VAP+L++VE+RK+GGDTLEFHKFYK  ++GLKD+VW+  +E KEE
Sbjct:  206 KGYDGAKADLWSCGVILFVLMAGYLPFEDSNLTSLYKKIFKAEFTCPPWFSASAKKLIKRILDPNPATRITFAEVIENEWFKKGYKAPKFENAD-VSLDDVDAIFDDSGESKNLVVERREEGLKTPVTMNAFELISTSQGLNLGSLFEKQMGLVKRKTRFTSKSSANEIVTKIEAAAAPMGFDVKTNNYKMKLTGEKSGRKGQLAVATEVFQVAPSLYMVEMRKSGGDTLEFHKFYKNLTTGLKDIVWKTIDEEKEE 461          
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPKN_ORYSJ (CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 5.639e-91
Identity = 160/251 (63.75%), Postives = 208/251 (82.87%), Query Frame = -3
Query:  164 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEEVNLDDVDAIFNDSKEN---LVTEKKEKPVSMNAFELISRTKSFSLENLFEKQT-GLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNYKMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQAEEN 904
            KGYDG   D+WSCGVILFVLMAG+LPF++SNLM+LY+KI +ADFSCPSWFS+ AKKLIK+ILDPN  TR+TI++++ +EWFKKGY+PP F+   +VNLDD+++IFN+S +    +V  ++E+P  MNAFELIS ++  +L  LFEKQ+ G VKRETRF S+ P NEI+SKIE AA P+GFNV+K NYK+KLQG+  GRKGQL++ATEVFEV P+L++VE+RK+ GDTLEFHKFY   S+GLKDV+W+ E +
Sbjct:  188 KGYDGAKADLWSCGVILFVLMAGYLPFEDSNLMSLYKKIFKADFSCPSWFSTSAKKLIKKILDPNPSTRITIAELINNEWFKKGYQPPRFE-TADVNLDDINSIFNESGDQTQLVVERREERPSVMNAFELISTSQGLNLGTLFEKQSQGSVKRETRFASRLPANEILSKIEAAAGPMGFNVQKRNYKLKLQGENPGRKGQLAIATEVFEVTPSLYMVELRKSNGDTLEFHKFYHNISNGLKDVMWKPESS 437          
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPKV_ORYSJ (CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 2.799e-90
Identity = 160/250 (64.00%), Postives = 203/250 (81.20%), Query Frame = -3
Query:  158 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEEVNLDDVDAIFNDSKENLVTEKKE-KPVSMNAFELISRTKSFSLENLFEKQTGLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNYKMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQAEENKE 904
            +GYDG A D+WSCGVIL+VL+AGFLPF++ N++ALY+KI  A F+CPSWFS+GAKKLI RILDPN  TR+TISQ+LED WFKKGYKPP FD++ E + DDVDA F DS++  V E+ E +P SMNAFELIS  ++ +L+NLFE +    KRETRFTSQ PP EI++KIEEAAKPLGF+++K NYKM+++  K GRKG L+VATEVF+VAP+LH+VE++K  GDTLEF KFY+  S+ LKDVVW+ +   E
Sbjct:  195 RGYDGAAADIWSCGVILYVLLAGFLPFEDDNIIALYKKISEAQFTCPSWFSTGAKKLITRILDPNPTTRITISQILEDPWFKKGYKPPVFDEKYETSFDDVDAAFGDSEDRHVKEETEDQPTSMNAFELISLNQALNLDNLFEAKKE-YKRETRFTSQCPPKEIITKIEEAAKPLGFDIQKKNYKMRMENLKAGRKGNLNVATEVFQVAPSLHVVELKKAKGDTLEFQKFYRTLSTQLKDVVWKCDGEVE 443          
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPKW_ORYSJ (CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2)

HSP 1 Score: 322.783 bits (826), Expect = 1.698e-87
Identity = 156/251 (62.15%), Postives = 201/251 (80.08%), Query Frame = -3
Query:  152 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEEVNLDDVDAIFNDSKENLVTEKKEKPVSMNAFELISRTKSFSLENLFEKQTGLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNYKMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQAEENKEEL 904
            +GYDG   D+WSCGVILFVL+AG+LPF++SNLM LY+KI  A+F+ P W S  AK+L+ RILDPN  TR+TI ++LEDEWFKKGYK P FD++ +  LDDV A+FNDS+E+ VTEKKE+P ++NAFELIS +   +L NLF+ +    KRETRFTS+ PP EI+ KIEEAAKPLGF+V+K NYK++L+  K GRKG L+VATE+ +VAP+LH+VEVRK  GDTLEFHKFYK  S  LKDVVW++++ + +L
Sbjct:  188 QGYDGAMADLWSCGVILFVLLAGYLPFEDSNLMTLYKKISNAEFTFPPWTSFPAKRLLTRILDPNPMTRVTIPEILEDEWFKKGYKRPEFDEKYDTTLDDVYAVFNDSEEHHVTEKKEEPEALNAFELISMSAGLNLGNLFDSEQEF-KRETRFTSKCPPKEIVRKIEEAAKPLGFDVQKKNYKLRLEKVKAGRKGNLNVATEILQVAPSLHMVEVRKAKGDTLEFHKFYKNLSRTLKDVVWKSDDLQNQL 437          
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPKQ_ARATH (CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=2 SV=2)

HSP 1 Score: 321.242 bits (822), Expect = 4.940e-87
Identity = 153/248 (61.69%), Postives = 198/248 (79.84%), Query Frame = -3
Query:  164 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEEVNLDDVDAIFNDSKENLVTEKK-EKPVSMNAFELISRTKSFSLENLFEKQTGLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNYKMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQAEEN 904
            +GYDG   D+WSCGVILFVL+AG+LPF++SNLM LY+KI   ++ CP W S GAK LI RILDPN  TR+TI ++L D WFKK YKP  F+++EE NLDDVDA+F DS+E+ VTEKK E+P SMNAFELIS +++  L NLFE++ G  KRETRF ++   N+++ KIEEA+KPLGF+++K NYKM+L+    GRKG L VATE+F+V+P+LH++EVRKT GDTLEFHKFYKK S+ L DVVW++ E+
Sbjct:  188 QGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWFKKNYKPAVFEEKEEANLDDVDAVFKDSEEHHVTEKKEEQPTSMNAFELISMSRALDLGNLFEEEEGF-KRETRFAAKGAANDLVQKIEEASKPLGFDIQKKNYKMRLENVTAGRKGNLRVATEIFQVSPSLHMIEVRKTKGDTLEFHKFYKKLSTSLNDVVWKSGES 434          
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPK3_ARATH (CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2)

HSP 1 Score: 318.161 bits (814), Expect = 4.182e-86
Identity = 151/251 (60.16%), Postives = 199/251 (79.28%), Query Frame = -3
Query:  155 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEEVNLDDVDAIFNDSKENLVTEKK-EKPVSMNAFELISRTKSFSLENLFEKQTGLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNYKMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQAEENKEE 904
            +GYDG   D+WSCGV+L+VL+AG+LPFD+SNLM LY+KI   +F+CP W S GA KLI RILDPN  TR+T  ++ EDEWFKK YKPP F++ ++ N+DD+DA+F DS+E+LVTEK+ E+P ++NAFE+IS ++  +LENLF+ +    KRETR T +   NEI+ KIEEAAKPLGF+V+K NYKM+L+  K GRKG L+VATE+F+VAP+LH+V+V K+ GDTLEFHKFYKK S+ L+ VVW   E K+E
Sbjct:  189 RGYDGATADMWSCGVVLYVLLAGYLPFDDSNLMNLYKKISSGEFNCPPWLSLGAMKLITRILDPNPMTRVTPQEVFEDEWFKKDYKPPVFEERDDSNMDDIDAVFKDSEEHLVTEKREEQPAAINAFEIISMSRGLNLENLFDPEQEF-KRETRITLRGGANEIIEKIEEAAKPLGFDVQKKNYKMRLENVKAGRKGNLNVATEIFQVAPSLHMVQVSKSKGDTLEFHKFYKKLSNSLEQVVWTNNEVKKE 438          
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPKX_ORYSJ (CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 2.076e-85
Identity = 157/267 (58.80%), Postives = 202/267 (75.66%), Query Frame = -3
Query:  152 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEEVNLDDVDAIFNDSKENLVTEKKEKPVSMNAFELISRTKSFSLENLFEKQTGLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNY----------------KMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQAEENKEEL 904
            +GYDG   D+WSCGVILFVL+AG+LPF++SNLM LY+KI  A+F+ P W S  AK+L+ RILDPN  TR+TI ++LEDEWFKKGYK P FD++ +  LDDVDA+FNDS+E+ VTEKKE+P ++NAFELIS +   +L NLF+ +    KRETRFTS+ PP EI+ KIEEAAKPLGF+V+K NY                K++L+  K GRKG L+VATE+ +VAP+LH+VEVRK  GDTLEFHKFYK  S  LKDVVW++++ + +L
Sbjct:  188 QGYDGAMADLWSCGVILFVLLAGYLPFEDSNLMTLYKKISNAEFTFPPWTSFPAKRLLTRILDPNPMTRITIPEILEDEWFKKGYKRPEFDEKYDTTLDDVDAVFNDSEEHHVTEKKEEPEALNAFELISMSAGLNLGNLFDSEQEF-KRETRFTSKCPPKEIVRKIEEAAKPLGFDVQKKNYKICSPCLTTICMNIPFKLRLEKVKAGRKGNLNVATEILQVAPSLHMVEVRKAKGDTLEFHKFYKNLSRTLKDVVWKSDDLQNQL 453          
BLAST of DT214585 vs. ExPASy Swiss-Prot
Match: CIPK3_ORYSJ (CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 4.479e-80
Identity = 146/252 (57.94%), Postives = 190/252 (75.40%), Query Frame = -3
Query:  152 KGYDGRAFDVWSCGVILFVLMAGFLPFDESNLMALYRKICRADFSCPSWFSSGAKKLIKRILDPNXDTRMTISQMLEDEWFKKGYKPPHFDKEEEVNLDDVDAIFNDSKENLVTE-KKEKPVSMNAFELISRTKSFSLENLFEKQTGLVKRETRFTSQRPPNEIMSKIEEAAKPLGFNVRKGNYKMKLQGDKTGRKGQLSVATEVFEVAPTLHIVEVRKTGGDTLEFHKFYKKFSSGLKDVVWQAEENKEEL 904
            KGYDG   D+WSCGVILFVL+AG+LPF++ N+++LY KI  A F+CPSWFS+ AK+LI RILDPN  TR+T SQ+L+D+WFKKGY+ P FD +      DV   F DS+E  V E  +E+P  MNAFELIS  K  +L+N FE      KRETRFTSQ PP EI+++IEEAA  LGFN++K NY+M+++  K GRKG L++ATEVF+VAP+LH+VE++K  GDTLEF KFY+  S+ LKDVVW+ E+  E++
Sbjct:  194 KGYDGALADLWSCGVILFVLLAGYLPFEDENIVSLYNKISGAQFTCPSWFSAEAKRLIARILDPNPATRITTSQVLQDQWFKKGYESPVFDDKYYPYFHDVYDAFGDSEEKHVKEAMEEQPTLMNAFELISLNKGLNLDNFFESDK-KYKRETRFTSQCPPKEIINRIEEAANLLGFNIQKRNYRMRMENIKEGRKGHLNIATEVFQVAPSLHVVELKKAKGDTLEFQKFYQTLSTQLKDVVWELEDAAEDM 444          
The following BLAST results are available for this feature:
BLAST of DT214585 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 112
Match NameE-valueIdentityDescription
CIPK9_ARATH1.093e-11076.10CBL-interacting serine/threonine-protein kinase 9 ... [more]
CIPK9_ORYSJ2.883e-10373.79CBL-interacting protein kinase 9 OS=Oryza sativa s... [more]
CIPKN_ARATH6.025e-9364.98CBL-interacting serine/threonine-protein kinase 23... [more]
CIPKN_ORYSJ5.639e-9163.75CBL-interacting protein kinase 23 OS=Oryza sativa ... [more]
CIPKV_ORYSJ2.799e-9064.00CBL-interacting protein kinase 31 OS=Oryza sativa ... [more]
CIPKW_ORYSJ1.698e-8762.15CBL-interacting protein kinase 32 OS=Oryza sativa ... [more]
CIPKQ_ARATH4.940e-8761.69CBL-interacting serine/threonine-protein kinase 26... [more]
CIPK3_ARATH4.182e-8660.16CBL-interacting serine/threonine-protein kinase 3 ... [more]
CIPKX_ORYSJ2.076e-8558.80CBL-interacting protein kinase 33 OS=Oryza sativa ... [more]
CIPK3_ORYSJ4.479e-8057.94CBL-interacting protein kinase 3 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_02I16_f2 Parent Washington Navel Orange Red Scale-Infested Rind cDNA Library UCRCS11-2 Citrus sinensis cDNA clone CS_WEd0002b_E08_VN, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214585 ID=DT214585|Name=DT214585|organism=Citrus sinensis|type=EST|length=906bp
GGCTTTTAGTTCTGTCCACTTCATTTCGCCAGCGAATAACATTCATTTCC
TATTTCTTGAAAATGTGTTTGTACGCATTCACTTACAGAAACCAAAACAA
ATTAGAAGAATTAACTAATAATTGACCCATCTGCAGTTGTTGTCACGCCC
TTAATTCTTCTTTATTTTCTTCCGCTTGCCAGACAACATCTTTCAGTCCC
GATGAAAATTTTTTGTAGAACTTGTGAAACTCTAGCGTGTCGCCACCAGT
TTTGCGAACCTCCACAATGTGCAAAGTGGGAGCCACCTCAAACACCTCAG
TAGCTACAGAGAGCTGGCCTTTCCTTCCAGTTTTATCACCTTGTAACTTC
ATCTTGTAGTTTCCCTTGCGAACATTAAATCCAAGAGGCTTTGCAGCTTC
CTCAATTTTAGACATGATTTCATTTGGAGGGCGTTGGGAAGTAAAACGAG
TTTCTCGCTTCACAAGGCCCGTTTGTTTCTCAAACAAATTTTCAAGGCTG
AAACTCTTGGTCCTAGAGATTAGCTCGAAAGCATTCATTGATACAGGCTT
CTCTTTCTTCTCAGTTACAAGATTTTCCTTCGAGTCATTGAAGATAGCAT
CAACATCATCGAGATTCACTTCCTCTTCCTTATCAAAATGTGGTGGTTTG
TACCCTTTCTTGAACCATTCATCCTCTAACATTTGAGAAATAGTCATTCG
TGTATCANGGTTTGGATCAAGAATACGCTTGATTAGTTTCTTGGCACCAG
ATGAAAACCATGACGGACAAGAGAAATCAGCCCTGCAAATTTTTCTATAC
AAAGCCATAAGATTCGACTCATCAAAAGGCAAGAACCCAGCCATAAGTAC
AAAGAGAATAACCCCGCAGGACCAAACATCAAATGCTCTACCGTCGTATC
CCTTGT
back to top