DT214583

Overview
NameDT214583
Unique NameDT214583
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length776
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214583 vs. ExPASy Swiss-Prot
Match: Y3028_ARATH (Uncharacterized acetyltransferase At3g50280 OS=Arabidopsis thaliana GN=At3g50280 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.631e-45
Identity = 98/248 (39.52%), Postives = 142/248 (57.26%), Query Frame = -2
Query:   53 RGFLSESEYFPIRLPLWSIEPSGTHTPP-----PNLRQRVFHFTKENIAKLKAKANAEIG-STNKISSLQAILSQIWRSFTRNRSLDPDEEVLFMLGIGVRQRLQPPLPPEYFGNAAQGEFVSMKARYQLEQGLGNVALKMNKFIAAYTEEKIKNFLESWGKNPEILTWD-SLPMKNNACFASSSPRFNFYGNDFGWGRPMAVRSGPANKVDGKITLFAGVEEGSVDVEACFLAQTLQGMGNDTEFMQ 775
            +G   +   FPI +P+   E S    PP     P  ++RVFHFTK NI+ LKAK N EIG   +K+SSLQA+ + +WRS  R+  L+ +E+    + + +RQRL PPL  E FG+      V+       +QGLG   L++N  + + T E  + + E+W +N +I        M  ++   SSSPRF  Y NDFGWG+P+AVR+GP+N + GK+  F G+EEG +DV A  L   L  +  D EF++
Sbjct:  197 KGLFVDGMDFPIHIPVSDTETS----PPSRELSPTFKERVFHFTKRNISDLKAKVNGEIGLRDHKVSSLQAVSAHMWRSIIRHSGLNQEEKTRCFVAVDLRQRLNPPLDKECFGHVIYNSVVTTTVGELHDQGLGWAFLQINNMLRSLTNEDYRIYAENWVRNMKIQKSGLGSKMTRDSVIVSSSPRFEVYDNDFGWGKPIAVRAGPSNSISGKLVFFRGIEEGCIDVHAFLLPDVLVKLLADVEFLE 440          
BLAST of DT214583 vs. ExPASy Swiss-Prot
Match: DCR_ARATH (BAHD acyltransferase DCR OS=Arabidopsis thaliana GN=DCR PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.607e-27
Identity = 73/216 (33.80%), Postives = 111/216 (51.39%), Query Frame = -2
Query:   56 PPNLRQRVFHFTKENIAKLKAKANAEI--GSTNKISSLQAILSQIWRSFTRNRSLDPDEEVLFMLGIGVRQRLQPPLPPEYFGNAAQGEFVSMKARYQLEQGLGNVALKMNKFIAAYTEEKIKNFLESWGKNPEILTWDSLPMKNNACFASSSPRFNFYGNDFGWGRPMAVRSGPANKVDGKITLFAGVEEG-SVDVEACFLAQTLQGMGNDTEFM 694
            PP L +++F F+   +  +K++AN+ I   S+   S+ Q++ S IWR  T  R L P++  +F +    R+R+ PP+P EYFGN  Q  F    A      G    A  + K IAA+    I    + W K+P+I  +    +  N     SSPRF  Y  DFG+G+P  VRSG  N+ +G + L+ G   G S+DVE    A  ++ +    EF+
Sbjct:  235 PPQLVEKIFRFSDFAVHTIKSRANSVIPSDSSKPFSTFQSLTSHIWRHVTLARGLKPEDITIFTVFADCRRRVDPPMPEEYFGNLIQAIFTGTAAGLLAAHGPEFGASVIQKAIAAHDASVIDARNDEWEKSPKIFQFKDAGV--NCVAVGSSPRFRVYEVDFGFGKPETVRSGSNNRFNGMMYLYQGKAGGISIDVEITLEASVMEKLVKSKEFL 448          
The following BLAST results are available for this feature:
BLAST of DT214583 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
Y3028_ARATH3.631e-4539.52Uncharacterized acetyltransferase At3g50280 OS=Ara... [more]
DCR_ARATH7.607e-2733.80BAHD acyltransferase DCR OS=Arabidopsis thaliana G... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_02C22_f2 Parent Washington Navel Orange Red Scale-Infested Rind cDNA Library UCRCS11-2 Citrus sinensis cDNA clone CS_WEd0002b_B11_VN, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214583 ID=DT214583|Name=DT214583|organism=Citrus sinensis|type=EST|length=776bp
TCGTTATGAGCAAGCCCCGAGCGCGGAAGATTTTTGACAATTAAGATACA
AATTGCATGAATTCTGTATCATTTCCCATACCTTGCAGTGTCTGAGCCAA
AAAGCAAGCTTCAACGTCGACACTCCCTTCTTCCACTCCGGCAAACAGGG
TGATCTTCCCATCAACCTTGTTCGCTGGACCACTCCTCACTGCCATTGGT
CTTCCCCACCCGAAATCGTTACCGTAGAAATTGAACCTCGGTGAACTACT
TGCGAAGCAAGCATTATTCTTCATCGGCAGGCTATCCCATGTTAGGATCT
CAGGGTTTTTTCCCCAAGACTCCAAGAAGTTCTTTATCTTTTCTTCAGTA
TAAGCAGCGATGAACTTGTTCATTTTCAATGCCACATTTCCAAGCCCTTG
CTCAAGTTGATATCTCGCTTTCATGGACACGAACTCTCCCTGAGCTGCAT
TTCCAAAATATTCTGGTGGCAGTGGCGGTTGCAATCTTTGTCTGACTCCG
ATTCCTAACATGAAAAGAACTTCTTCATCAGGATCAAGAGATCGATTACG
AGTAAATGATCGCCAGATCTGGGAAAGGATTGCTTGGAGAGAGGAGATCT
TGTTGGTACTACCAATCTCAGCATTGGCTTTTGCTTTGAGTTTTGCAATG
TTTTCCTTCGTAAAGTGGAAAACCCTTTGTCGCAAATTAGGCGGTGGAGT
GTGAGTTCCGGAAGGTTCAATGCTCCAGAGAGGGAGGCGAATGGGGAAAT
ATTCTGATTCAGAGAGAAACCCACGT
back to top