DT214580

Overview
NameDT214580
Unique NameDT214580
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length843
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214580_ssr648 microsatellite DT214580_ssr648:648..659. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10386 contig Csv1_Contig10386:23..865. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: TNKS1_HUMAN (Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 9.627e-18
Identity = 58/157 (36.94%), Postives = 82/157 (52.23%), Query Frame = -3
Query:  197 DLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSEL-PEPDTEARRILE 664
            +L  AA+ G+   L   L  L+ +       + T LHL   Y  +  VQLLL+ GA + AKD+ G +PLH+AC+ G  E+ +LL+   +   CV  M    D    TPLH AA    V+V  LLL+ GA PT  N +GK+  ++ P P+   R   E
Sbjct:  338 ELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGA---CVNAM----DLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYE 487          

HSP 2 Score: 85.1149 bits (209), Expect = 5.283e-16
Identity = 55/176 (31.25%), Postives = 85/176 (48.30%), Query Frame = -3
Query:  200 DGVNMDLESETPPHLRD----LAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSEL-PEPDTEARRIL 712
            + V   L   TP    D    L  A++ GD+ +++    + + +  +      T LH    Y  +  V+ LL  GA + AKD+ G +PLH+AC+ G  E+ +LL+   +        +   D    TPLH AA     ++ +LLL  GA PTK N  G TP +L  E DT+ + +L
Sbjct:  633 EAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGAS-------VNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLL 801          

HSP 3 Score: 82.8037 bits (203), Expect = 2.622e-15
Identity = 56/171 (32.75%), Postives = 84/171 (49.12%), Query Frame = -3
Query:  182 LRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSELPEPDTEA--------RRILEVAASG 670
            LR+L  A + GDV  ++  +D  + +  +    + + LH    +G    V+ LL+ GA++ A+D+ G IPLH+AC+ G  E+V LL+       C        D    TPLH AA    +DV  +LL  GA P   N  GK+  +L +P  +A          +LE A SG
Sbjct:  183 LRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLL-------CQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSG 346          

HSP 4 Score: 76.2554 bits (186), Expect = 2.454e-13
Identity = 47/115 (40.87%), Postives = 59/115 (51.30%), Query Frame = -3
Query:  221 TALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSELPEPD 565
            T LHL   Y  L   + LLE GA + A+D+ G IPLH+A + G ++I  LLI       CV       D    TPLH AA+     +  LLLA GA PT  N  G+TP +L   D
Sbjct:  839 TPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKY---NTCV----NATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATAD 946          
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: TNKS2_HUMAN (Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.390e-16
Identity = 53/157 (33.76%), Postives = 82/157 (52.23%), Query Frame = -3
Query:  200 RDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSEL-PEPDTEARRIL 667
            R L  AA+ GDV +++      S +  +    + T LH    Y  +  V+ LL+ GA + AKD+ G +PLH+AC+ G  E+ +LL+   +       ++   D    TPLH AA     ++ +LLL  GA PTK N  G TP +L  + DT+ + +L
Sbjct:  494 RQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGA-------VVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLL 643          

HSP 2 Score: 84.3445 bits (207), Expect = 9.011e-16
Identity = 55/157 (35.03%), Postives = 80/157 (50.96%), Query Frame = -3
Query:  197 DLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSEL-PEPDTEARRILE 664
            +L  +A+ G+   +   L  L+ +       + T LHL   Y  +  VQLLL+ GA + AKD+   +PLH+AC+ G  E+ +LL+   +   CV  M    D    TPLH AA    V+V  LLL+ GA PT  N + K+  +L P P  + R   E
Sbjct:  180 ELLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGA---CVNAM----DLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDLAPTPQLKERLAYE 329          

HSP 3 Score: 83.9593 bits (206), Expect = 1.177e-15
Identity = 61/179 (34.08%), Postives = 86/179 (48.04%), Query Frame = -3
Query:  182 PHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTA------LHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSELPEPDTEA--------RRILEVAASG 676
            P  R+L  A + GDV  ++  +        E V  RDTA      LH    +G    V+ LL+ GA+++A+D+ G IPLH+AC+ G  E+V LL+   +            D    TPLH AA    +DV  +LL  GA PT  N  G+T  +L +P  +A          +LE A SG
Sbjct:   23 PAARELFEACRNGDVERVKRLVT------PEKVNSRDTAGRKSTPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADP-------NARDNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLESARSG 188          

HSP 4 Score: 74.3294 bits (181), Expect = 9.325e-13
Identity = 45/115 (39.13%), Postives = 59/115 (51.30%), Query Frame = -3
Query:  221 TALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSELPEPD 565
            T LHL   Y  L   + LL+ GA + A+D+ G IPLH+A + G +++  LLI       CV       D    TPLH AA+     +  LLLA GA PT  N  G+TP +L   D
Sbjct:  681 TPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKY---NACV----NATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDLVSAD 788          
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: BARD1_HUMAN (BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 1.816e-16
Identity = 41/117 (35.04%), Postives = 69/117 (58.97%), Query Frame = -3
Query:  218 DTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSELPEPDT 568
            +T LH+  + G +P V+ LL+ G+    KD  G  PLH+AC  G +++V+LL+         K ++ T   + D+PLH AA+  HVD+++LLL+ GAS    N++G  P +  + ++
Sbjct:  429 ETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQH-------KALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDES 538          
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: ASB13_MOUSE (Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 9.011e-16
Identity = 58/168 (34.52%), Postives = 84/168 (50.00%), Query Frame = -3
Query:  254 TPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLIN-------------------SASGTECVKRM------LETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLY 682
            TP H      AAQ G+   L+  +D+    +++   D  T LH   L G   CVQLLL  GA ++A++ DG+ PL DACA G IE V+LL++                    +  +ECV+ +      LE  D    TPLH A   EH+D +++LL +GA+   A L+
Sbjct:   21 TPVH-----EAAQRGESLQLQQLIDS-GACVNQVTVDSITPLHAASLQGQAQCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLH 182          

HSP 2 Score: 72.0182 bits (175), Expect = 4.628e-12
Identity = 53/186 (28.49%), Postives = 90/186 (48.39%), Query Frame = -3
Query:  155 DLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSELPEPDTEARRILEV-----AASGQTCQ*SLSK 697
            +++  TP     L  A   G +  ++L L +    ++ P+    + LH  C+ G   CV+LL++ GA+LEA D     PLH ACA   ++ V++L+N+ +     K          +T LHHAA+ ++VD+I +L+  G +    +  GK PS+     +   +  E       +  Q C+ SL K
Sbjct:   82 NIDGSTP-----LCDACASGSIECVKLLL-SYGAKVNPPLYTA-SPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLH--------ETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLSLSQLCRVSLRK 252          
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: ASB13_HUMAN (Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.424e-15
Identity = 57/168 (33.93%), Postives = 84/168 (50.00%), Query Frame = -3
Query:  254 TPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLIN-------------------SASGTECVKRM------LETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLY 682
            TP H      AAQ G+   L+  +++    +++   D  T LH   L G   CVQLLL  GA ++A++ DG+ PL DACA G IE V+LL++                    +  +ECV+ +      LE  D    TPLH A   EH+D +++LL +GA+   A L+
Sbjct:   21 TPVH-----EAAQRGESLQLQQLIES-GACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLH 182          

HSP 2 Score: 71.633 bits (174), Expect = 6.044e-12
Identity = 47/154 (30.52%), Postives = 80/154 (51.95%), Query Frame = -3
Query:  236 DLESETPPHLRDLAAAAQLGDVHSLRLALDNLSGSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSE 697
            +++  TP     L  A   G +  ++L L +    ++ P+    + LH  C+ G   CV+LL++ GA+LEA D     PLH ACA   ++ V++L+N+ +     K          +T LHHAA+ ++VD+I +L+  G +    +  GK PS+
Sbjct:   82 NIDGSTP-----LCDACASGSIECVKLLL-SYGAKVNPPLYTA-SPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLH--------ETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSD 220          
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: ANKR1_RABIT (Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.472e-15
Identity = 54/167 (32.34%), Postives = 80/167 (47.90%), Query Frame = -3
Query:  233 LRLALDNLSGSIDEPVEDRD----------TALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETV--------------------------DAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSEL 625
            L+ AL+N    +++ + D++          TALH  CL G+L  V+ L+E GA +E +D   +  +H AC GG +E+++LL+N  +      ++L T                           D EGDTPLH A R     +IRLL+  GA  T  N  GKTP +L
Sbjct:  125 LKAALENKLAVVEKFLSDQNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWACRGGNLEVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLTIKNSAGKTPMDL 291          
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: BARD1_RAT (BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 9.962e-15
Identity = 38/116 (32.76%), Postives = 66/116 (56.90%), Query Frame = -3
Query:  221 DTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSELPEPD 568
            +T LH+  + G +  V+ LL+ G     KD  G  PLH+AC+ G ++IV+LL+           ++ T     D+PLH AA+  H+D++++LL+ GAS    N++G+ P +  + +
Sbjct:  419 ETLLHIASIKGDISSVEYLLQNGNDPNVKDHAGWTPLHEACSHGHLKIVELLLQH-------NALVNTTGYHNDSPLHDAAKNGHIDIVKVLLSHGASRNAVNIFGERPVDYTDAE 527          
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: BARD1_MOUSE (BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.301e-14
Identity = 37/109 (33.94%), Postives = 63/109 (57.80%), Query Frame = -3
Query:  242 DTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETVDAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTP 568
            +T LH+  + G +P V+ LL+ G     KD  G  PLH+AC+ G +++V+LL+           ++ T   + D+PLH A +  H+D++++LL+ GAS    N++G  P
Sbjct:  417 ETLLHIASIKGDIPSVEYLLQNGNDPNVKDHAGWTPLHEACSHGHLKVVELLLQH-------NALVNTPGYQNDSPLHDAVKSGHIDIVKVLLSHGASRNAVNIFGVRP 518          
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: ANKR1_RAT (Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.219e-14
Identity = 52/167 (31.14%), Postives = 79/167 (47.31%), Query Frame = -3
Query:  233 LRLALDNLSGSIDEPVEDRD----------TALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETV--------------------------DAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSEL 625
            L+ AL+N    +++ + D++          TALH  CL G+L  V+ L+E GA +E +D   +  +H AC GG +++++LL+N  +      ++L T                           D EGDTPLH A R     +IRLL+  GA     N  GKTP +L
Sbjct:  125 LKAALENKLPVVEKFLSDKNSPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWACRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLMTFGADLNVKNCAGKTPMDL 291          
BLAST of DT214580 vs. ExPASy Swiss-Prot
Match: ANKR2_MOUSE (Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 4.944e-14
Identity = 56/183 (30.60%), Postives = 82/183 (44.81%), Query Frame = -3
Query:  170 GSIDEPVEDRDTALHLTCLYGYLPCVQLLLERGASLEAKDEDGAIPLHDACAGGFIEIVQLLINSASGTECVKRMLETV--------------------------DAEGDTPLHHAARGEHVDVIRLLLASGASPTKANLYGKTPSEL--------------PEPDTEARRILEVAASGQTCQ 598
            GS D   E R TALH   L G++  ++ LLE GA+++ +D      +H AC GG +E+V+LL +  + T    ++L T                           D EGD+ LH A R     +I+LLL  GA     NL GKTP++L              PEP++E   +    +  +T Q
Sbjct:  171 GSADTCDEFRRTALHRASLEGHMEILEKLLENGATVDFQDRLDCTAMHWACRGGHLEVVRLLQSRGADTNVRDKLLSTPLHVAVRTGHVEIVEHFLSLGLDINAKDREGDSALHDAVRLNRYKIIKLLLLHGADMMAKNLAGKTPTDLVQLWQADTRHALEHPEPESEQNGLERPGSGRETPQ 353          
The following BLAST results are available for this feature:
BLAST of DT214580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
TNKS1_HUMAN9.627e-1836.94Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2[more]
TNKS2_HUMAN1.390e-1633.76Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1[more]
BARD1_HUMAN1.816e-1635.04BRCA1-associated RING domain protein 1 OS=Homo sap... [more]
ASB13_MOUSE9.011e-1634.52Ankyrin repeat and SOCS box protein 13 OS=Mus musc... [more]
ASB13_HUMAN3.424e-1533.93Ankyrin repeat and SOCS box protein 13 OS=Homo sap... [more]
ANKR1_RABIT4.472e-1532.34Ankyrin repeat domain-containing protein 1 OS=Oryc... [more]
BARD1_RAT9.962e-1532.76BRCA1-associated RING domain protein 1 OS=Rattus n... [more]
BARD1_MOUSE1.301e-1433.94BRCA1-associated RING domain protein 1 OS=Mus musc... [more]
ANKR1_RAT2.219e-1431.14Ankyrin repeat domain-containing protein 1 OS=Ratt... [more]
ANKR2_MOUSE4.944e-1430.60Ankyrin repeat domain-containing protein 2 OS=Mus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01I15_f2 Parent Washington Navel Orange Red Scale-Infested Rind cDNA Library UCRCS11-2 Citrus sinensis cDNA clone CS_WEd0001a_E08_VN, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214580 ID=DT214580|Name=DT214580|organism=Citrus sinensis|type=EST|length=843bp
CTCATCAAGATGTATGGCCCCCTATCTCATTTAGGGTTCTGAAATCAATA
GATAACAAAGTTTTAATCGAATTCCAAACATACCTATCTATGAAAAAAAA
AAAAAAGTAACGAGAGCAGTCAAAACAGAAATAAAGTTCACATAATATCA
GCTATTTCGATAGAGATTACTGGCAGGTCTGACCACTAGCAGCAACTTCT
AGAATTCTCCTAGCCTCGGTGTCTGGCTCGGGTAACTCACTTGGGGTCTT
TCCATAGAGGTTTGCCTTTGTAGGAGAAGCACCAGAAGCCAGCAACAATC
TTATGACATCCACGTGTTCACCTCTTGCCGCATGATGAAGAGGAGTATCA
CCTTCAGCATCAACAGTTTCTAACATCCTTTTTACACATTCAGTGCCGCT
AGCACTATTAATTAGAAGTTGAACTATCTCAATAAACCCCCCAGCACAAG
CATCATGCAGAGGAATTGCTCCATCTTCATCCTTGGCCTCCAAACTAGCC
CCTCGTTCCAAGAGTAGCTGAACACAAGGCAGATAGCCATAGAGGCATGT
CAGATGGAGAGCAGTGTCCCTGTCTTCTACTGGTTCATCAATACTACCAC
TCAAGTTATCTAGAGCGAGACGGAGGGAATGAACGTCGCCGAGCTGAGCG
GCGGCGGCGAGGTCACGGAGGTGAGGTGGAGTTTCCGATTCGAGGTCCAT
ATTAACGCCGTCTTCTTCAAAGAGAGCGTTATCTTCTTCGCTATCATCTT
CCTCCATCATTCCGTTGCGCGGTACCGCCATTTTTTCTCCTAATTAACTT
TTTTATAACGGTGTTTTGCAGAGAAAAGTAGAATGAAAACCCT
back to top