DT214569

Overview
NameDT214569
Unique NameDT214569
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length730
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6249 contig Csv1_Contig6249:4..734. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS_LACSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Lactuca sativa GN=RBCS PE=2 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 5.740e-82
Identity = 138/177 (77.97%), Postives = 157/177 (88.70%), Query Frame = -2
Query:  139 ISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPGV 669
            ISS+ +AT NR +  QAS+ APFTGLKS+ AFP TKK NND +S+ SNGGRVQCMKVWPP GLKK+ETLSYLPPLSDEAL KEI+YLIR+ WIPCLEFELE G+VYREHH SPGYYDGRYWTMWKLPM+GCTD+ QV+KEVGE +KEYP++F+R+IGFDN RQVQCISFI AKPPGV
Sbjct:    4 ISSSAIATVNRTTSTQASLAAPFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPPGV 180          
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS_FAGCR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Fagus crenata GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 4.859e-81
Identity = 143/180 (79.44%), Postives = 161/180 (89.44%), Query Frame = -2
Query:  145 MASSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPP 684
            MASSMISSATVAT +RA+ AQA+MVAPFTGLKS++AFPAT+K+NNDITS+ASNGGRVQCMKVWPP GL+KFETLSYLPPLS E+L K+I YLI  GWIPCLEFELE  +VYRE+++SPGYYDGRYW MWKLPM+GCTDATQVL E+ E  K YP S +RIIGFDNKRQVQCISFIA KPP
Sbjct:    1 MASSMISSATVATVSRATPAQATMVAPFTGLKSTAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLAKQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180          
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS_BETVE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Betula verrucosa GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.082e-80
Identity = 143/182 (78.57%), Postives = 161/182 (88.46%), Query Frame = -2
Query:  139 MASSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPGV 684
            MA SMISSATVA  +RAS AQ+SMVAPFT LKS+SAFP T+KTNNDITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E L KE++YL+R   IPCLEFELE G+VYREH++SPGYYDGRYWTMWKLPM+GC D++QVLKE+ E +K YP +F+RIIGFDNKRQVQ ISFIA KPPGV
Sbjct:    1 MACSMISSATVAAVSRASPAQSSMVAPFTCLKSTSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLAKEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAFIRIIGFDNKRQVQIISFIAYKPPGV 182          
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS_PYRPY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Pyrus pyrifolia GN=RBCS PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.666e-79
Identity = 142/183 (77.60%), Postives = 161/183 (87.98%), Query Frame = -2
Query:  142 MASSMISSATVAT--ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 684
            MASSMISS TVAT  A+R + AQA MVAPF GLKSSSAFP T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE++YL+R  W+PCLEFELE G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISFIA KP G
Sbjct:    1 MASSMISSGTVATVSADRPAPAQARMVAPFNGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS_MALSP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Malus sp. GN=RBCS PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 7.757e-79
Identity = 142/183 (77.60%), Postives = 161/183 (87.98%), Query Frame = -2
Query:  142 MASSMISSATVAT--ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 684
            MASSMISS TVAT  A+R + AQA MVAPFTGLKSSSA P T+K+N DITSIASNGGRVQCM+VWPP GLKKFETLSYLPPLS E+L KE++YL+R  W+PCLEFELE G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISFIA KP G
Sbjct:    1 MASSMISSGTVATVSADRPAPAQARMVAPFTGLKSSSASPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS_MEDSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.728e-78
Identity = 134/176 (76.14%), Postives = 155/176 (88.07%), Query Frame = -2
Query:  148 SMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKP 675
            ++ISSA V T NRAS AQA++VAPFTGLKSS+ FP TKKTNNDITSIASNGGRV CM+VWPP G KKFETLSYLPPL++E L KE+ YLIR GWIPCLEFELEKG+VYRE+H+SPGYYDGRYWTMW+LP++G TD++QVLKE+ + + EYP SF+RIIGFDN RQVQCISFIA  P
Sbjct:    2 ALISSAAVTTVNRASSAQANLVAPFTGLKSSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLEFELEKGFVYRENHRSPGYYDGRYWTMWRLPLFGATDSSQVLKELADCKAEYPDSFIRIIGFDNVRQVQCISFIAHTP 177          
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS_MANES (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Manihot esculenta PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 6.567e-78
Identity = 135/181 (74.59%), Postives = 154/181 (85.08%), Query Frame = -2
Query:  142 MASSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 684
            MASSM+S+ATVA+ NR S AQA+MVAPFTGLKS+  FP T+KTN+DITSI SNGG+VQCMKVWP  G+KKFETLSYLPPL+ E L  E+ YL+RSGWIPCLEFELE G VYREH + PGYYDGRYWTMWKLPM+GCTDA QVLKE+ E+ K +P  + RIIGFDN RQVQCISF+A KPPG
Sbjct:    1 MASSMLSTATVASINRVSPAQATMVAPFTGLKSTPVFPTTRKTNSDITSITSNGGKVQCMKVWPTLGMKKFETLSYLPPLTREQLASEVEYLLRSGWIPCLEFELEHGLVYREHARVPGYYDGRYWTMWKLPMFGCTDAAQVLKELDELIKHHPDGYARIIGFDNVRQVQCISFLAYKPPG 181          
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS3_SOLTU (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Solanum tuberosum GN=RBCS-3 PE=3 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.463e-77
Identity = 136/182 (74.73%), Postives = 161/182 (88.46%), Query Frame = -2
Query:  142 MASSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNN-DITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 684
            MASS++SSA VAT  R+++AQASMVAPFTGLKS+++FP TKK NN DITS+ASNGGRV+CM+VWPP  +KK+ETLSYLP LSDE LLKE+ YL+++GW+PCLEFE E G+VYRE+HKSPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISFIA KP G
Sbjct:    1 MASSIVSSAAVAT--RSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS_HEVBR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Hevea brasiliensis GN=RBCS PE=2 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.911e-77
Identity = 136/181 (75.14%), Postives = 154/181 (85.08%), Query Frame = -2
Query:  142 MASSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPPG 684
            MASSM+S+A VA  NRAS AQASMVAPFTGLKS+SAFP T+KT  DITSIASNGGRVQCM+VWPP G K +ETLSYLPPL+ E L KE+ YL+R GW+PCLEFELE G VYRE+H+SPGYYDGRYWTMWKLPM+GCTDA QVL+E+ E+ K YP  + RIIGFDN RQVQCISF+A KP G
Sbjct:    1 MASSMLSTAAVACINRASPAQASMVAPFTGLKSTSAFPTTRKTTTDITSIASNGGRVQCMQVWPPRGKKFYETLSYLPPLTREQLAKEVEYLLRKGWVPCLEFELEHGTVYREYHRSPGYYDGRYWTMWKLPMFGCTDAVQVLQELDEMIKAYPDCYGRIIGFDNVRQVQCISFLAYKPKG 181          
BLAST of DT214569 vs. ExPASy Swiss-Prot
Match: RBS3B_ARATH (Ribulose bisphosphate carboxylase small chain 3B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-3B PE=1 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 9.483e-77
Identity = 137/180 (76.11%), Postives = 154/180 (85.56%), Query Frame = -2
Query:  145 MASSMISSATVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEINYLIRSGWIPCLEFELEKGWVYREHHKSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKPP 684
            MASSM+SSA V T    S AQA+MVAPFTGLKSS+AFP T+KTN DITSIASNGGRV CMKVWPP G KKFETLSYLP LSD  L KE++YL+R+ WIPC+EFELE G+VYREH  +PGYYDGRYWTMWKLP++GCTD+ QVLKEV E +KEYP +F+RIIGFDN RQVQCISFIA KPP
Sbjct:    1 MASSMLSSAAVVT----SPAQATMVAPFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176          
The following BLAST results are available for this feature:
BLAST of DT214569 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 128
Match NameE-valueIdentityDescription
RBS_LACSA5.740e-8277.97Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_FAGCR4.859e-8179.44Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_BETVE1.082e-8078.57Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_PYRPY2.666e-7977.60Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MALSP7.757e-7977.60Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MEDSA1.728e-7876.14Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MANES6.567e-7874.59Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS3_SOLTU1.463e-7774.73Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS_HEVBR1.911e-7775.14Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS3B_ARATH9.483e-7776.11Ribulose bisphosphate carboxylase small chain 3B, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_24A08_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-24A08-A16-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214569 ID=DT214569|Name=DT214569|organism=Citrus sinensis|type=EST|length=730bp
TGAGCAGCAGCAACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCC
CATTGATCGAACGTTCATGATGGGGGTTACACATAATAATAATCAACAAT
ATTGCATGGGTGGTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGG
CTTGGCAGCAATGAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATC
CGATAATTCGGACGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACC
TCCTTCAAAACCTGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCA
CATTGTCCAGTAGCGTCCATCGTAGTATCCTGGTGACTTGTGGTGCTCAC
GGTACACCCATCCTTTCTCCAACTCGAATTCCAAGCAGGGAATCCAGCCG
GAGCGGATAAGGTAATTGATTTCCTTGAGCAAAGCTTCATCGGACAGTGG
CGGGAGGTATGAGAGAGTCTCGAACTTCTTCAAGCCAGTTGGTGGCCACA
CCTTCATGCATTGGACTCTTCCGCCGTTGCTTGCAATGGAAGTAATGTCA
TTGTTGGTCTTCTTGGTTGCTGGGAAAGCAGAAGAAGACTTGAGGCCGGT
GAAGGGGGCGACCATGCTGGCCTGAGCAAGGCTGGCGCGGTTCGCGGTGG
CAACGGTGGCCGATGAGATCATTGAGGAAGCCATTGGTACTTGCTCCTTC
AAAAGCTATAATAATAAATTTTAAAAAAAA
back to top