DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_LACSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Lactuca sativa GN=RBCS PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.907e-34
Identity = 61/78 (78.21%), Postives = 72/78 (92.31%), Query Frame = -3
Query:  127 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPGV 360
            L+ G+VYREHH SPGYYDGRYWTMWKLPM+GCTD+ QV+KEVGE +KEYP++F+R+IGFDN RQVQCISF+ AKPPGV
Sbjct:  103 LEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPPGV 180          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_HORVU (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.194e-32
Identity = 58/74 (78.38%), Postives = 69/74 (93.24%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+++REH++SPGYYDGRYWTMWKLPM+GCTDATQVL EV EV+KEYP ++VRIIGFDN RQVQC+SF+A KPPG
Sbjct:   94 GFIFREHNASPGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 167          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_WHEAT (Ribulose bisphosphate carboxylase small chain PW9, chloroplastic OS=Triticum aestivum PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.194e-32
Identity = 58/74 (78.38%), Postives = 69/74 (93.24%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+V+REH+SSPGYYDGRYWTMWKLPM+GCTDATQVL EV EV+KEYP ++VR+IGFDN RQVQC+SF+A +PPG
Sbjct:   95 GFVFREHNSSPGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRVIGFDNMRQVQCVSFIAFRPPG 168          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_MUSAC (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Musa acuminata GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.784e-32
Identity = 61/84 (72.62%), Postives = 71/84 (84.52%), Query Frame = -3
Query:  130 WVA*LQ---KGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 372
            W+  L+   KG+V+RE+H SPGYYDGRYWTMWKLPM+GCTDA QV KEV E +KEYPH+F+RIIGFDN RQVQCISF+A KP G
Sbjct:   96 WIPCLEFCPKGFVWRENHRSPGYYDGRYWTMWKLPMFGCTDAVQVAKEVEECKKEYPHAFIRIIGFDNNRQVQCISFIAYKPTG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_WHEAT (Ribulose bisphosphate carboxylase small chain PWS4.3, chloroplastic OS=Triticum aestivum PE=3 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 6.784e-32
Identity = 58/74 (78.38%), Postives = 69/74 (93.24%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+V+REH+SSPGYYDGRYWTMWKLPM+GCTDATQVL EV EV+KEYP ++VR+IGFDN RQVQC+SF+A +PPG
Sbjct:   94 GFVFREHNSSPGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRVIGFDNLRQVQCVSFIAFRPPG 167          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_WHEAT (Ribulose bisphosphate carboxylase small chain clone 512 (Fragment) OS=Triticum aestivum PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 8.860e-32
Identity = 57/74 (77.03%), Postives = 69/74 (93.24%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+++REH++SPGYYDGRYWTMWKLPM+GCTDATQV+ EV EV+KEYP ++VRIIGFDN RQVQC+SF+A KPPG
Sbjct:   33 GFIFREHNASPGYYDGRYWTMWKLPMFGCTDATQVINEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 106          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_SINAL (Ribulose bisphosphate carboxylase small chain (Fragment) OS=Sinapis alba GN=RBCS PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.511e-31
Identity = 58/76 (76.32%), Postives = 69/76 (90.79%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREH S+PGYYDGRYWTMWKLP++GCTD+ QVLKEV E +KEYP++F+RIIGFDN RQVQCISF+A KPP
Sbjct:    2 LEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKPP 77          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_GLYTA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Glycine tabacina GN=RBCS PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.974e-31
Identity = 58/76 (76.32%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREHH SPGYYDGRYWTMWKLPM+GCTDA+QVLKE+ E +  YP++F+RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNAFIRIIGFDNVRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1A_ARATH (Ribulose bisphosphate carboxylase small chain 1A, chloroplastic OS=Arabidopsis thaliana GN=RBCS-1A PE=1 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 1.974e-31
Identity = 58/76 (76.32%), Postives = 69/76 (90.79%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREH +SPGYYDGRYWTMWKLP++GCTD+ QVLKEV E +KEYP++F+RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS8_NICPL (Ribulose bisphosphate carboxylase small chain 8B, chloroplastic OS=Nicotiana plumbaginifolia GN=RBCS-8B PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.578e-31
Identity = 59/76 (77.63%), Postives = 67/76 (88.16%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            ++G+VYREHH SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISF+A KP G
Sbjct:  104 ERGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS_LACSA1.907e-3478.21Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_HORVU5.194e-3278.38Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_WHEAT5.194e-3278.38Ribulose bisphosphate carboxylase small chain PW9,... [more]
RBS_MUSAC6.784e-3272.62Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS1_WHEAT6.784e-3278.38Ribulose bisphosphate carboxylase small chain PWS4... [more]
RBS3_WHEAT8.860e-3277.03Ribulose bisphosphate carboxylase small chain clon... [more]
RBS_SINAL1.511e-3176.32Ribulose bisphosphate carboxylase small chain (Fra... [more]
RBS_GLYTA1.974e-3176.32Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS1A_ARATH1.974e-3176.32Ribulose bisphosphate carboxylase small chain 1A, ... [more]
RBS8_NICPL2.578e-3177.63Ribulose bisphosphate carboxylase small chain 8B, ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top