DT214563

Overview
NameDT214563
Unique NameDT214563
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length865
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: Y5838_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380 OS=Arabidopsis thaliana GN=At5g48380 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.322e-53
Identity = 105/159 (66.04%), Postives = 128/159 (80.50%), Query Frame = -1
Query:  410 LSTFVNGEFGDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNA------PESFKGSLVEWITLLNTNSSLETAIDKSLLGNGFDGELHQFLRVACNCVLP-TPKERHTMFEVYQLLRAIAERYHFTTDDEIMLPSNTGDPNFPDELIVA 865
            LSTFVNGEFGD GYVAPEY RT+VATPKGDVYSFGVVLLEL+TG++ T +T         E+FKG+LVEWIT L++ S L+ AID+SLLGNG D E+ + L+VACNCVLP   K+R TMFEVYQLLRAI E Y+FT DD+I++PS +G+ +F +ELIVA
Sbjct:  461 LSTFVNGEFGDFGYVAPEYSRTMVATPKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESKLQEAIDRSLLGNGVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLLRAIGESYNFTADDDILIPSESGEGDFIEELIVA 619          
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: Y1719_ARATH (Probable inactive receptor kinase At1g27190 OS=Arabidopsis thaliana GN=At1g27190 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.111e-32
Identity = 64/125 (51.20%), Postives = 92/125 (73.60%), Query Frame = -1
Query:  488 STFVNGEFGDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEWITLLNTNSSLETAIDKSLLGNGFDGELHQFLRVACNCVLPTPKERHTMFEVYQLLRAIAERY 862
            S+F NG+ G+LGYVAPEY  T+VA+ KGDVY FG+VLLEL+TG++P  + N  E FKGSLV+W++        + AID+S+   G D E+ QFL++AC+CV+  PKER TM +VY+ L+ +A+++
Sbjct:  459 SSFNNGDLGELGYVAPEYSSTMVASLKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICDKGHDEEILQFLKIACSCVVSRPKERPTMIQVYESLKNMADKH 583          
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: Y1699_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g69990 OS=Arabidopsis thaliana GN=At1g69990 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.952e-30
Identity = 65/140 (46.43%), Postives = 95/140 (67.86%), Query Frame = -1
Query:  449 STFVNGEFGDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEWITLLNTNSSLETAIDKSLLGNGFDGELHQFLRVACNCVLPTPKERHTMFEVYQLLRAIAERYHFTTD--DEIMLPSN 862
            S+F NG+FG   YVAPEY  T+VA+  GDVY FG+VLLE++TG++P  + N  E FK SLVEW++   +N   + AID+ + G G+D E+ Q LR+AC+CV+  PKER  M +VY+ L+ + +++ F ++  DE  L  N
Sbjct:  449 SSFSNGKFG---YVAPEYSSTMVASLSGDVYGFGIVLLEIVTGQKPVLINNGEEGFKESLVEWVSKHLSNGRSKDAIDRRIFGKGYDDEIMQVLRIACSCVVSRPKERPLMIQVYESLKNLGDQHGFFSEYSDEFPLIFN 585          
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: Y5148_ARATH (Probable leucine-rich repeat receptor-like protein kinase At5g61480 OS=Arabidopsis thaliana GN=At5g61480 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.591e-15
Identity = 53/143 (37.06%), Postives = 79/143 (55.24%), Query Frame = -1
Query:  425 GDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNAPESFKG-SLVEWI-TLLNTNSSLETAIDKSLLGNG---FDGELHQFLRVACNCVLPTPKERHTMFEVYQLLRAIAERYHFTTDDEIMLPSNTGDPNFPD 838
            G  GY+APEY  TL    K D+YS+GV+LLE+ITG+R       PE  +G S+V+W+ + L T   +E  +DKS +G        E+ Q LR+A  C   +P +R  M +V  +L+  A+    T  D +++  +  D NF D
Sbjct:  888 GSYGYIAPEYAYTLQVDKKSDIYSYGVILLEIITGKRSVE----PEFGEGNSIVDWVRSKLKTKEDVEEVLDKS-MGRSCSLIREEMKQMLRIALLCTSRSPTDRPPMRDVLLILQE-AKPKRKTVGDNVIVVGDVNDVNFED 1024          
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: BAK1_ARATH (BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 4.690e-15
Identity = 47/127 (37.01%), Postives = 70/127 (55.12%), Query Frame = -1
Query:  464 GDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEWITLLNTNSSLETAIDKSLLGNGFDGELHQFLRVACNCVLPTPKERHTMFEVYQLLR--AIAERYHFTTDDEI 838
            G +G++APEY  T  ++ K DV+ +GV+LLELITG+R   L          L++W+  L     LE  +D  L GN  D E+ Q ++VA  C   +P ER  M EV ++L    +AER+     +E+
Sbjct:  454 GTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAERWEEWQKEEM 580          
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 80.4925 bits (197), Expect = 1.365e-14
Identity = 42/102 (41.18%), Postives = 58/102 (56.86%), Query Frame = -1
Query:  533 GDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEWITLLNTNSSLETAIDKSLLGNGFDGELHQFLRVACNCVLPTPKERHT 838
            G LGY+ PEY +  VAT KGDVYSFGVVLLEL+T +RP  +   P+  +  L+ W+  +   S      D  +     D E+ + L +AC C+   PK+R T
Sbjct:  898 GTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTDKRPVDMCK-PKGCR-DLISWVVKMKHESRASEVFDPLIYSKENDKEMFRVLEIACLCLSENPKQRPT 997          
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: PSYR1_ARATH (Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.970e-14
Identity = 44/113 (38.94%), Postives = 63/113 (55.75%), Query Frame = -1
Query:  500 GDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEWITLLNTNSSLETAIDKSLLGNGFDGELHQFLRVACNCVLPTPKERHTMFEVYQLLRAI 838
            G LGY+ PEY +  VAT +GDVYSFGVV+LEL+TG+RP  +     S    LV W+  +  +   E   D  L  +G +  + + L +AC CV   P +R  + +V   L+ I
Sbjct:  967 GTLGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPMEVFRPKMS--RELVAWVHTMKRDGKPEEVFDTLLRESGNEEAMLRVLDIACMCVNQNPMKRPNIQQVVDWLKNI 1077          
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: EXS_ARATH (Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.970e-14
Identity = 49/123 (39.84%), Postives = 72/123 (58.54%), Query Frame = -1
Query:  500 LSTFVNGEFGDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEW-ITLLNTNSSLETAIDKSLLGNGFDGELHQFLRVACNCVLPTPKERHTMFEVYQLLRAI 865
            +ST + G FG   Y+ PEY ++  AT KGDVYSFGV+LLEL+TG+ PT   +  ES  G+LV W I  +N   +++  ID  L+         + L++A  C+  TP +R  M +V + L+ I
Sbjct: 1075 VSTVIAGTFG---YIPPEYGQSARATTKGDVYSFGVILLELVTGKEPTG-PDFKESEGGNLVGWAIQKINQGKAVD-VIDPLLVSVALKNSQLRLLQIAMLCLAETPAKRPNMLDVLKALKEI 1192          
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: SERK2_ARATH (Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.155e-13
Identity = 42/119 (35.29%), Postives = 66/119 (55.46%), Query Frame = -1
Query:  488 GDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEWITLLNTNSSLETAIDKSLLGNGFDGELHQFLRVACNCVLPTPKERHTMFEVYQLLR--AIAERY 838
            G +G++APEY  T  ++ K DV+ +G++LLELITG+R   L          L++W+  L     LE  +D  L  N  + E+ Q ++VA  C   +P ER  M EV ++L    +AE++
Sbjct:  470 GTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAEKW 588          
BLAST of DT214563 vs. ExPASy Swiss-Prot
Match: PSKR1_DAUCA (Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.155e-13
Identity = 44/113 (38.94%), Postives = 57/113 (50.44%), Query Frame = -1
Query:  500 GDLGYVAPEYPRTLVATPKGDVYSFGVVLLELITGERPTHLTNAPESFKGSLVEWITLLNTNSSLETAIDKSLLGNGFDGELHQFLRVACNCVLPTPKERHTMFEVYQLLRAI 838
            G LGY+ PEY +  VAT KGDVYSFGVVLLEL+TG RP  +     S    L+ W+  + T        D  +       E+   L +AC C+   PK R T  ++   L  I
Sbjct:  907 GTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTGRRPMDVCKPRGS--RDLISWVLQMKTEKRESEIFDPFIYDKDHAEEMLLVLEIACRCLGENPKTRPTTQQLVSWLENI 1017          
The following BLAST results are available for this feature:
BLAST of DT214563 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
Y5838_ARATH3.322e-5366.04Probably inactive leucine-rich repeat receptor-lik... [more]
Y1719_ARATH1.111e-3251.20Probable inactive receptor kinase At1g27190 OS=Ara... [more]
Y1699_ARATH3.952e-3046.43Probable LRR receptor-like serine/threonine-protei... [more]
Y5148_ARATH3.591e-1537.06Probable leucine-rich repeat receptor-like protein... [more]
BAK1_ARATH4.690e-1537.01BRASSINOSTEROID INSENSITIVE 1-associated receptor ... [more]
PSKR1_ARATH1.365e-1441.18Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]
PSYR1_ARATH3.970e-1438.94Tyrosine-sulfated glycopeptide receptor 1 OS=Arabi... [more]
EXS_ARATH3.970e-1439.84Leucine-rich repeat receptor protein kinase EXS OS... [more]
SERK2_ARATH1.155e-1335.29Somatic embryogenesis receptor kinase 2 OS=Arabido... [more]
PSKR1_DAUCA1.155e-1338.94Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_20D11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-20D11-H22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214563 ID=DT214563|Name=DT214563|organism=Citrus sinensis|type=EST|length=865bp
TACTCAGTTACAAAGCAACCATAATAGCTTCAGCAAACAGGAGGATAAGC
CGCCACCCACAGGACACTAATTGGAAATTTACAACGCTAAAGGGAATGCC
AAAATGATTACAGTCACTGCAAAAAGCAACATTTTTTGCATCAATAATCA
GTCACAAAGCCAAAGGAGAACTTTTACGTATACAGCAGAGCTTCAGCATC
CTAGTTGACTATATATACAGTTAGTAGTTGAAACATAGGCAAGCTACTAA
AGATTGTTCATACTTTGTATAAATATACTGCTGAATATATGAATAAATTT
TACATCATTTCGGCTATTATAAAAAAAGAAAAACCAAATATCTTAAAAAC
ACCTTTCGTCATTGTATTGAACTTAATAAATACCAACGCCATGCATAAAA
TTACGTGTAAGCAACAATAAGTTCATCAGGAAAATTGGGATCGCCTGTGT
TAGATGGCAGCATGATCTCATCATCAGTTGTGAAATGATACCTCTCCGCA
ATGGCTCTGAGAAGCTGATACACTTCAAACATGGTGTGTCTCTCCTTTGG
AGTTGGCAACACACAGTTACAAGCAACCCTAAGAAATTGGTGGAGTTCAC
CATCAAAACCATTTCCAAGCAGGGACTTATCAATTGCAGTTTCCAGAGAA
GAGTTAGTGTTCAGAAGTGTGATCCACTCCACTAAACTTCCCTTGAAGCT
CTCAGGGGCATTAGTTAAATGAGTTGGTCTCTCACCTGTGATCAGTTCCA
GGAGAACAACTCCAAAGCTATAAACATCCCCCTTTGGGGTGGCTACCAGC
GTCCGTGGATATTCAGGAGCAACATAACCTAAATCTCCGAACTCCCCATT
GACAAAAGTACTCAA
back to top