DT214562

Overview
NameDT214562
Unique NameDT214562
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6529 contig Csv1_Contig6529:1..644. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214562 vs. ExPASy Swiss-Prot
Match: ZDHC9_ARATH (Probable S-acyltransferase At3g26935 OS=Arabidopsis thaliana GN=At3g26935 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.036e-25
Identity = 67/123 (54.47%), Postives = 79/123 (64.23%), Query Frame = -1
Query:  285 VGGGFMSPNMGKAGDDIEMGRKTVWGDVGPG-GDLTEGQLPNNDRINVKDGELAELSPDIRTTV-EEGDRVGIHPXXXXXXXXXXXWDMSPELTALAARI-ESNRAXXXXXXXXXXXTENRQT 644
            V GGFMSPNMGKA D+IEMGRK VW D+GP   D  +G+  NN+R++VKDGEL ELSPDIR TV E+ DR  +HP           WDMSPE+ ALAAR+ E N+            TENR T
Sbjct:  321 VAGGFMSPNMGKANDEIEMGRKAVWADMGPAMSDHGDGKHGNNERLHVKDGELGELSPDIRATVDEQSDRPSMHPRRSSWGRKSGSWDMSPEVMALAARVGEQNQNGGGSSSGSGLVTENRPT 443          
BLAST of DT214562 vs. ExPASy Swiss-Prot
Match: ZDH23_ARATH (Probable S-acyltransferase At5g41060 OS=Arabidopsis thaliana GN=At5g41060 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.127e-14
Identity = 51/100 (51.00%), Postives = 61/100 (61.00%), Query Frame = -1
Query:  354 VGGGFMSPNMGKAGDDIEMGRKTVWGDVGPGGDLTEGQLPNNDRINVKDGELAELSPDIRTTV---EEGDRVGIHPXXXXXXXXXXXWDMSPELTALAAR 644
            V GGFMSPNMGKA DDIEMGRK VW  +   GD  +G   NN+R +V D EL ELSPD+   V   E+ +R   HP           W+MSPE+ AL+AR
Sbjct:  319 VVGGFMSPNMGKANDDIEMGRKGVWA-MAEHGDGKDGN--NNERFHVNDNELNELSPDMGNIVNGDEQINRPNNHP-------RNANWEMSPEVMALSAR 408          
The following BLAST results are available for this feature:
BLAST of DT214562 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
ZDHC9_ARATH1.036e-2554.47Probable S-acyltransferase At3g26935 OS=Arabidopsi... [more]
ZDH23_ARATH3.127e-1451.00Probable S-acyltransferase At5g41060 OS=Arabidopsi... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_20B05_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-20B05-D10-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214562 ID=DT214562|Name=DT214562|organism=Citrus sinensis|type=EST|length=644bp
GGTGACCTAGAGCCCACACTGGGGATCTAAAGCACTAACTGAATCCACAA
ATACAATCCATTTAGGGACTAACTAATTCCACAAATACAAAATCAGAACC
AAAAGAAGCTCAATCATACAACACAACAAACCATTCCTTTTTGAAATCAC
AATTCCCAAACCAGCACTTTCATACACCCTTTTCAAAACAAAACTCCCCA
TATTGCACAAGAAATAGTGGAAGTTGAATGACTAGGTATGAAATCTCAGG
GATATACATCAGTAATTTGTCACAGCTTCCGCTATGTTTGTCTATTCTCA
GTTGTCAAGTTGCTGCTGCTAGTACCACTCCCACCTGCACGATTTGATTC
AATTCTAGCAGCCAAAGCAGTAAGCTCAGGTGACATGTCCCAGCTTCCAC
TTTTTCTTCCCCAACTAGATCGCCTGGGATGGATTCCAACACGATCCCCT
TCCTCTACTGTAGTCCTAATATCCGGGGACAACTCAGCTAATTCACCATC
TTTAACATTTATCCGATCATTGTTTGGCAGTTGTCCTTCTGTGAGATCAC
CTCCAGGACCAACATCTCCCCACACCGTTTTCCTACCCATTTCTATGTCA
TCCCCAGCTTTCCCCATATTTGGACTCATAAAACCCCCACCTAC
back to top