DT214549

Overview
NameDT214549
Unique NameDT214549
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length697
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: TXND5_HUMAN (Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 5.938e-17
Identity = 44/111 (39.64%), Postives = 62/111 (55.86%), Query Frame = -3
Query:  333 KSEVITLTQDTFTDKVKEKDTAWFVKFCVPWCKHCKNLGSLWEDLGKA-MXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAE 662
            K  V+ LT++ F D + E  T  F+KF  PWC HCK L   WE+L K              DC A + +CSK  +  YPT  +F  GK+V+++ G RD++SL  FVL +A+
Sbjct:  321 KGTVLALTENNFDDTIAEGIT--FIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQAK 429          

HSP 2 Score: 75.0998 bits (183), Expect = 3.983e-13
Identity = 38/102 (37.25%), Postives = 51/102 (50.00%), Query Frame = -3
Query:  342 TQDTFTDKVKEKDTAWFVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXD--CGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLE 641
            T D FT  ++    A FV F  PWC HC+ L   W DLG                 C A   +CS   +  YPT K+F  G+E  KYQGPRD ++L+ ++L+
Sbjct:   67 TADMFTHGIQS--AAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQ 166          

HSP 3 Score: 75.0998 bits (183), Expect = 3.983e-13
Identity = 36/93 (38.71%), Postives = 48/93 (51.61%), Query Frame = -3
Query:  315 FVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAEKAATKA 593
            F+KF  PWC HCK L   WE L   +           DC     LCS   +  YPT   F DGK+V +Y+G RD+ESL+ +V  + ++  T A
Sbjct:  209 FIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGA 301          
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: TXND5_MOUSE (Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 7.756e-17
Identity = 44/111 (39.64%), Postives = 63/111 (56.76%), Query Frame = -3
Query:  333 KSEVITLTQDTFTDKVKEKDTAWFVKFCVPWCKHCKNLGSLWEDLGKA-MXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAE 662
            K  V+ LT+ +F D + +  T  FVKF  PWC HCKNL   WE+L K              DC A + +CSK  +  YPT  +F  G++V ++ G RD++SL +FVL +A+
Sbjct:  306 KGTVLALTEKSFEDTIAQGIT--FVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAK 414          

HSP 2 Score: 76.2554 bits (186), Expect = 1.788e-13
Identity = 43/131 (32.82%), Postives = 62/131 (47.33%), Query Frame = -3
Query:  201 FVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAEKAATKAQLGGDKEL*QVVVLASKTRMANSHQNANGSILTLSAAS 593
            F+KF  PWC HCK L   WE L   +           DC     +CS+  +  YPT   F DGK+V +Y+G RD+ESL+ +V         ++QL G +   + V  +    MA       G++L L+  S
Sbjct:  195 FIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYV---------QSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKS 316          

HSP 3 Score: 75.8702 bits (185), Expect = 2.335e-13
Identity = 39/102 (38.24%), Postives = 50/102 (49.02%), Query Frame = -3
Query:  342 TQDTFTDKVKEKDTAWFVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXD--CGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLE 641
            T D FT  ++    A FV F  PWC HC+ L   W DLG                 C A   +CS   +  YPT K F  G+E  KYQGPRD E+L+ ++L+
Sbjct:   53 TADMFTHGIQS--AAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQ 152          
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: PDIA3_RAT (Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.335e-13
Identity = 41/125 (32.80%), Postives = 64/125 (51.20%), Query Frame = -3
Query:  324 LSLSLAMIHSKSEVITLTQDTFTDKVKEKDTA--WFVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAEKAA 692
            L L+ A++ S S+V+ LT + F  +V +  +A    V+F  PWC HCK L   +E    A            DC A+   C+K  +  YPT K+F DG+E   Y GPR  + + + + ++A  A+
Sbjct:   14 LLLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPAS 136          
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: PDIA3_CERAE (Protein disulfide-isomerase A3 OS=Cercopithecus aethiops GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.050e-13
Identity = 41/125 (32.80%), Postives = 63/125 (50.40%), Query Frame = -3
Query:  324 LSLSLAMIHSKSEVITLTQDTFTDKVKEKDTA--WFVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAEKAA 692
            L L+ A + + S+V+ LT D F  +V +  +A    V+F  PWC HCK L   +E    A            DC A+   C+K  +  YPT K+F DG+E   Y GPR  + + + + ++A  A+
Sbjct:   14 LLLAAARLAAASDVLELTDDNFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPAS 136          
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: PDIA3_PONAB (Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.983e-13
Identity = 40/125 (32.00%), Postives = 63/125 (50.40%), Query Frame = -3
Query:  324 LSLSLAMIHSKSEVITLTQDTFTDKVKEKDTA--WFVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAEKAA 692
            L L+ A + + S+V+ LT D F  ++ +  +A    V+F  PWC HCK L   +E    A            DC A+   C+K  +  YPT K+F DG+E   Y GPR  + + + + ++A  A+
Sbjct:   14 LLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPAS 136          
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: PDIA3_HUMAN (Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4)

HSP 1 Score: 75.0998 bits (183), Expect = 3.983e-13
Identity = 40/125 (32.00%), Postives = 63/125 (50.40%), Query Frame = -3
Query:  324 LSLSLAMIHSKSEVITLTQDTFTDKVKEKDTA--WFVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAEKAA 692
            L L+ A + + S+V+ LT D F  ++ +  +A    V+F  PWC HCK L   +E    A            DC A+   C+K  +  YPT K+F DG+E   Y GPR  + + + + ++A  A+
Sbjct:   14 LLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPAS 136          
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: PDIA6_ARATH (Probable protein disulfide-isomerase A6 OS=Arabidopsis thaliana GN=At2g47470 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.202e-13
Identity = 40/107 (37.38%), Postives = 57/107 (53.27%), Query Frame = -3
Query:  339 EVITLTQDTFTDKVKEKDTAWFVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGK-EVAKYQGPRDVESLKTFVLEE 656
            +V+ LT D+F  +V  KD    V+F  PWC HCK L   +E LG +            DC   K++C+K  +  YPT + F  G  E  KY+GPR+ E+L  +V +E
Sbjct:   24 DVVVLTDDSFEKEVG-KDKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKE 129          
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: PDIA3_MOUSE (Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.159e-12
Identity = 40/125 (32.00%), Postives = 63/125 (50.40%), Query Frame = -3
Query:  324 LSLSLAMIHSKSEVITLTQDTFTDKVKEKDTA--WFVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAEKAA 692
            L L+ A + + S+V+ LT + F  +V +  +A    V+F  PWC HCK L   +E    A            DC A+   C+K  +  YPT K+F DG+E   Y GPR  + + + + ++A  A+
Sbjct:   14 LLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPAS 136          
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: PDIA3_BOVIN (Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.977e-12
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = -3
Query:  324 LSLSLAMIHSKSEVITLTQDTFTDKVKEKDTA--WFVKFCVPWCKHCKNLGSLWEDLGKAMXXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGKEVAKYQGPRDVESLKTFVLEEAEKAA 692
            L L+ A + + S+V+ LT D F  ++ +  ++    V+F  PWC HCK L   +E    A            DC A+   C+K  +  YPT K+F DG+E   Y GPR  + + + + ++A  A+
Sbjct:   14 LLLAAARLAAASDVLELTDDNFESRITDTGSSGLMLVEFFAPWCGHCKKLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEESGAYDGPRTADGIVSHLKKQAGPAS 136          
BLAST of DT214549 vs. ExPASy Swiss-Prot
Match: ERP38_NEUCR (Protein disulfide-isomerase erp38 OS=Neurospora crassa GN=erp38 PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 9.811e-12
Identity = 44/128 (34.38%), Postives = 64/128 (50.00%), Query Frame = -3
Query:  303 AMIHSKSEVITLTQDTFTDKVKEKDTAWFVKFCVPWCKHCKNLGSLWEDLGKAM-XXXXXXXXXXXDCGASKTLCSKVDIHSYPTFKVFYDGK--EVAKYQGPRDVESLKTFVLEEAEKAATKAQLGG 677
            A + +KS V+ L    F D V +      V+F  PWC HCKNL  ++E+L  A+            D  A + L  +  +  +PT K F+DGK  +   Y+G RD++SL  F+   AEK   KA+  G
Sbjct:   14 AAVAAKSAVLDLIPSNFDDVVLKSGKPTLVEFFAPWCGHCKNLAPVYEELATALEYAKDKVQIAKVDADAERALGKRFGVQGFPTLK-FFDGKSEQPVDYKGGRDLDSLSNFI---AEKTGVKARKKG 137          
The following BLAST results are available for this feature:
BLAST of DT214549 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
TXND5_HUMAN5.938e-1739.64Thioredoxin domain-containing protein 5 OS=Homo sa... [more]
TXND5_MOUSE7.756e-1739.64Thioredoxin domain-containing protein 5 OS=Mus mus... [more]
PDIA3_RAT2.335e-1332.80Protein disulfide-isomerase A3 OS=Rattus norvegicu... [more]
PDIA3_CERAE3.050e-1332.80Protein disulfide-isomerase A3 OS=Cercopithecus ae... [more]
PDIA3_PONAB3.983e-1332.00Protein disulfide-isomerase A3 OS=Pongo abelii GN=... [more]
PDIA3_HUMAN3.983e-1332.00Protein disulfide-isomerase A3 OS=Homo sapiens GN=... [more]
PDIA6_ARATH5.202e-1337.38Probable protein disulfide-isomerase A6 OS=Arabido... [more]
PDIA3_MOUSE1.159e-1232.00Protein disulfide-isomerase A3 OS=Mus musculus GN=... [more]
PDIA3_BOVIN1.977e-1231.20Protein disulfide-isomerase A3 OS=Bos taurus GN=PD... [more]
ERP38_NEUCR9.811e-1234.38Protein disulfide-isomerase erp38 OS=Neurospora cr... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Seed cDNA Library UCRCS09-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS09_49G10_b2 Ruby Orange Developing Seed cDNA Library UCRCS09-2 Citrus sinensis cDNA clone UCRCS09-49G10-M20-1-7.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214549 ID=DT214549|Name=DT214549|organism=Citrus sinensis|type=EST|length=697bp
CGACGCCCTCTTTAAATGGGTAACATATTCACCTCAAGTGATTATGACCT
TTGGAGATATTCAACTACAAAATTCCTATTAAGGATATATAAGTACAGAA
TGGCTTGAAACATCTGCTAAATTAAAACAAACTCTGCACAAGACGAGATT
AATAAACAAAAACATGATTGATGAACCCTCCTATGGCCCCCTTGAGATCA
GGATGCAGCTGAAAGTGTGAGAATAGAACCATTTGCATTCTGATGGGAAT
TGGCCATCCTGGTTTTGCTGGCAAGTACCACAACTTGTCACAATTCCTTG
TCACCACCAAGCTGTGCTTTTGTTGCTGCTTTTTCTGCCTCTTCCAAAAC
AAATGTTTTAAGCGATTCAACATCCCTTGGCCCTTGATATTTTGCAACTT
CTTTTCCATCGTAAAAGACCTTAAATGTAGGATAGGAATGGATATCAACT
TTAGAGCATAAAGTCTTGCTTGCACCGCAGTCAACTTCTCCGACCTCTAT
TTCATCATCCCCTTCCATTGCCTTTCCCAGATCCTCCCATAACGACCCCA
AGTTCTTACAATGCTTACACCAAGGCACACAAAATTTCACAAACCATGCG
GTGTCTTTTTCCTTCACCTTGTCAGTGAATGTGTCTTGAGTTAACGTTAT
GACTTCGGACTTTGAATGAATCATTGCCAGGCTAAGCGAAAGAAGAA
back to top