DT214538

Overview
NameDT214538
Unique NameDT214538
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length634
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6527 contig Csv1_Contig6527:1..634. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214538 vs. ExPASy Swiss-Prot
Match: RK34_ARATH (50S ribosomal protein L34, chloroplastic OS=Arabidopsis thaliana GN=RPL34 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.038e-30
Identity = 66/86 (76.74%), Postives = 76/86 (88.37%), Query Frame = -2
Query:  163 GLSLGLDFNSN-AGVRKEKRQGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA 417
            GLS+  D +S  +G+  ++R+GLVVRAGKAALCQTKR+RSRKSLARTHGFRRRMRTTSGRA +KRRRAKGRW LCPKS P+SGKRA
Sbjct:   72 GLSIAFDLSSQTSGLNGQRRRGLVVRAGKAALCQTKRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGRWNLCPKSNPSSGKRA 157          
BLAST of DT214538 vs. ExPASy Swiss-Prot
Match: RK34_SPIOL (50S ribosomal protein L34, chloroplastic OS=Spinacia oleracea GN=RPL34 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 4.823e-28
Identity = 63/85 (74.12%), Postives = 71/85 (83.53%), Query Frame = -2
Query:  163 GLSLGLDFNSNAGVRKEKRQGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA 417
            GLSLGLD  SN GV  ++ +  VVRAGKAALC TKR+RSRKSLARTHGFR RM TTSGRA+LKRRRAKGR +LC K+ P+SGKRA
Sbjct:   66 GLSLGLDLTSNTGVSTDRCRRFVVRAGKAALCLTKRSRSRKSLARTHGFRLRMSTTSGRALLKRRRAKGRKILCTKTNPSSGKRA 150          
The following BLAST results are available for this feature:
BLAST of DT214538 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
RK34_ARATH1.038e-3076.7450S ribosomal protein L34, chloroplastic OS=Arabid... [more]
RK34_SPIOL4.823e-2874.1250S ribosomal protein L34, chloroplastic OS=Spinac... [more]
back to top
Libraries
Library NameType
Ruby Orange Developing Seed cDNA Library UCRCS09-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS09_1D08_b2 Ruby Orange Developing Seed cDNA Library UCRCS09-2 Citrus sinensis cDNA clone UCRCS09-1D08-G15-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214538 ID=DT214538|Name=DT214538|organism=Citrus sinensis|type=EST|length=634bp
TAACAGAAGGCGATGATAACAATGTGAATTTCATTTAACTGAATACCCCT
TTATGCCCAAATGGAACAACAAACAAAGCTTCTGATCAGGTTCAGAAGAT
CATCTGCGAACCACATTGAATATTAAAATTCACCTACTGAAACTGAATAC
AATGAGTAGTTAGGCACGCTTCCCACTATTGGGGTAGGACTTGGGACAAA
GTACCCACCGTCCTTTGGCTCTTCGACGCTTCAATATTGCTCTTCCACTA
GTGGTTCTCATCCGTCTGCGGAAGCCATGAGTGCGAGCTAGGGATTTTCG
AGACCTATTCCGCTTAGTTTGACACAGAGCAGCCTTCCCCGCCCTCACCA
CCAGACCCTGGCGTTTCTCCTTTCGCACCCCAGCATTAGAATTGAAATCT
AGCCCTAAGGATAGACCTGAAAAAGCTGAATGAAAAGCGGAAGAACATAA
AGAAGAGGAAACAAAGGAGCAGTGAAGAAGCCCAGGGCGAGATGGTGAGG
AGTTGTTGCCGGCAACATTCACCGACACAGAGCTTCTTCCCGTCCGCAGA
ATGAGAGAAGCAGAAGGAATTCTTCGTGAGTGATGTGTGCTTTTGCTAGT
AAGCCATGGTGGTGGGATTGATGTTGTTATCCCT
back to top