DT214536

Overview
NameDT214536
Unique NameDT214536
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length518
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: SCP40_ARATH (Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 1.737e-23
Identity = 46/99 (46.46%), Postives = 63/99 (63.64%), Query Frame = -1
Query:  138 RSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQGEXXXXXXXYQ-NLTFVTIRGAGHMVPSSQPARALAFFSSFL-DGKLPPAAK 428
            + LM  G+ V+++SGDTDG +P  S +YS+ K+    KTAW+P Y+ GE       Y+  LTF T+RGAGH VPS QP R+L+ F  FL D  LP  ++
Sbjct:  403 KELMGQGVRVWVFSGDTDGRIPVTSTKYSLKKMNLTAKTAWHPWYLGGEVGGYTEEYKGKLTFATVRGAGHQVPSFQPKRSLSLFIHFLNDTPLPDTSR 501          

HSP 2 Score: 35.4242 bits (80), Expect = 1.737e-23
Identity = 16/29 (55.17%), Postives = 21/29 (72.41%), Query Frame = -3
Query:  412 WQDCSDAVLRHWKDSPLTVVGGIQELNGQ 498
            WQ CS +V++ W DSP TV+  I+EL GQ
Sbjct:  381 WQPCS-SVIKKWNDSPTTVIPLIKELMGQ 408          
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: SCP32_ARATH (Serine carboxypeptidase-like 32 OS=Arabidopsis thaliana GN=SCPL32 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.263e-23
Identity = 50/98 (51.02%), Postives = 67/98 (68.37%), Query Frame = -1
Query:  138 FRSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQGEXXXXXXXYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPPAAK 431
            ++ L+A G  V++YSGDTDG VP +S RY INKL   +KTAW P Y + +       Y+ LTF T RGAGH VPS +P+ +LAFFS+FL+G  PP ++
Sbjct:  366 YKKLIAGGFRVWVYSGDTDGRVPVLSTRYCINKLELPIKTAWRPWYHETQVSGWFQEYEGLTFATFRGAGHDVPSFKPSESLAFFSAFLNGVPPPLSR 463          

HSP 2 Score: 22.7126 bits (47), Expect = 2.263e-23
Identity = 6/12 (50.00%), Postives = 8/12 (66.67%), Query Frame = -3
Query:  463 WQDCSDAVLRHW 498
            W  C+D +L HW
Sbjct:  342 WTICNDDILNHW 353          
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: SCP24_ARATH (Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 6.486e-23
Identity = 45/95 (47.37%), Postives = 59/95 (62.11%), Query Frame = -1
Query:  147 FRSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQGEXXXXXXXYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPP 431
            ++ L ASG+ ++I+SGDTD  VP  + R+S++ L   VKT WYP Y   +       Y+ LTF T+RGAGH VP  +P RAL  F SFL GK  P
Sbjct:  368 YKELAASGLRIWIFSGDTDSVVPVTATRFSLSHLNLPVKTRWYPWYTDNQVGGWTEVYKGLTFATVRGAGHEVPLFEPKRALILFRSFLAGKELP 462          

HSP 2 Score: 33.113 bits (74), Expect = 6.486e-23
Identity = 14/31 (45.16%), Postives = 20/31 (64.52%), Query Frame = -3
Query:  421 GIRGPWQDCSDAVLRHWKDSPLTVVGGIQEL 513
            GIR  W  CSD +++ WKDS  T++   +EL
Sbjct:  341 GIRYKWTACSDVLIKTWKDSDKTMLPIYKEL 371          
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: SCP31_ARATH (Serine carboxypeptidase-like 31 OS=Arabidopsis thaliana GN=SCPL31 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.680e-21
Identity = 46/98 (46.94%), Postives = 65/98 (66.33%), Query Frame = -1
Query:  138 FRSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQGEXXXXXXXYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPPAAK 431
            +  L+A G+ +++YSGDTDG VP ++ RYS+N L   +KTAW P Y + +       Y+ LTF T RGAGH VP  +P+ +LAFFS+FL G  PP ++
Sbjct:  368 YEKLIAGGLRIWVYSGDTDGRVPVLATRYSLNALELPIKTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAVPCFKPSSSLAFFSAFLSGVPPPPSR 465          
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: CBP2_WHEAT (Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.252e-20
Identity = 43/95 (45.26%), Postives = 58/95 (61.05%), Query Frame = -1
Query:  147 FRSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQGEXXXXXXXYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPP 431
            +R L+A+G+ ++++SGDTD  VP  + RYSI  LG    T+WYP Y   E       Y+ LT V++RGAGH VP  +P +AL  F  FL GK  P
Sbjct:  343 YRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMP 437          

HSP 2 Score: 28.8758 bits (63), Expect = 1.252e-20
Identity = 10/26 (38.46%), Postives = 16/26 (61.54%), Query Frame = -3
Query:  421 WQDCSDAVLRHWKDSPLTVVGGIQEL 498
            W  CSD +  HW D+P +++   +EL
Sbjct:  321 WATCSDTINTHWHDAPRSMLPIYREL 346          
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: CBP21_HORVU (Serine carboxypeptidase II-1 (Fragment) OS=Hordeum vulgare GN=CXP;2-1 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.686e-20
Identity = 43/95 (45.26%), Postives = 56/95 (58.95%), Query Frame = -1
Query:  147 FRSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQGEXXXXXXXYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPP 431
            +R L+A+GI ++++SGD D  VP  + RYSI+ L     T WYP Y + E       Y+ LT VTIRGAGH VP  +P +AL  F  FL  K  P
Sbjct:  221 YRELIAAGIRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQALKLFEHFLQDKPMP 315          

HSP 2 Score: 32.7278 bits (73), Expect = 4.686e-20
Identity = 14/31 (45.16%), Postives = 19/31 (61.29%), Query Frame = -3
Query:  421 GIRGPWQDCSDAVLRHWKDSPLTVVGGIQEL 513
            GI   W  CSD +  HWKDSP +++   +EL
Sbjct:  194 GIPYSWTACSDVLSDHWKDSPRSMLPIYREL 224          
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: SCP30_ARATH (Putative serine carboxypeptidase-like 30 OS=Arabidopsis thaliana GN=SCPL30 PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 6.940e-20
Identity = 43/91 (47.25%), Postives = 61/91 (67.03%), Query Frame = -1
Query:  159 FRSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQGEXXXXXXXYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDG 431
            ++ L+A G+ +++YSGDTDG +P +  RYS+N LG  +KTAW P Y + +       Y  LTF T RGAGH VPS +P+ +LAF S+F+ G
Sbjct:  387 YQKLIAGGLRIWVYSGDTDGCIPVLGTRYSLNALGLPIKTAWRPWYHEKQVSGWVQEYDGLTFATFRGAGHTVPSFKPSSSLAFISAFVKG 477          
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: SCP26_ARATH (Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.880e-20
Identity = 41/95 (43.16%), Postives = 55/95 (57.89%), Query Frame = -1
Query:  147 FRSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQGEXXXXXXXYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPP 431
            ++ L+A+G+ ++++SGDTD  VP    RYSI  L  +  + WYP    G+       Y+ LT VTI GAGH VP  +P RA   F SFLD K  P
Sbjct:  357 YKELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLFRPRRAFLLFQSFLDNKPLP 451          

HSP 2 Score: 33.8834 bits (76), Expect = 7.880e-20
Identity = 14/31 (45.16%), Postives = 20/31 (64.52%), Query Frame = -3
Query:  421 GIRGPWQDCSDAVLRHWKDSPLTVVGGIQEL 513
            G+  PW+ CSD V   W DSPL+++   +EL
Sbjct:  330 GLAYPWKGCSDIVGEKWADSPLSMLPIYKEL 360          
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: SCP29_ARATH (Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana GN=SCPL29 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.024e-19
Identity = 38/91 (41.76%), Postives = 57/91 (62.64%), Query Frame = -1
Query:  159 FRSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQGEXXXXXXXYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDG 431
            +  L+A+G+ ++++SGD D  VP  S RYSI+ L  +  +A+ P Y+ G+       Y  L FVT+RGAGH VP  +P +ALA F +F+ G
Sbjct:  368 YHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISG 458          

HSP 2 Score: 33.4982 bits (75), Expect = 1.024e-19
Identity = 13/26 (50.00%), Postives = 15/26 (57.69%), Query Frame = -3
Query:  421 WQDCSDAVLRHWKDSPLTVVGGIQEL 498
            W  CSD V  HW DSP +V+    EL
Sbjct:  346 WDTCSDVVSEHWNDSPSSVLNIYHEL 371          
BLAST of DT214536 vs. ExPASy Swiss-Prot
Match: CBP2_HORVU (Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CBP2 PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 1.332e-19
Identity = 43/96 (44.79%), Postives = 58/96 (60.42%), Query Frame = -1
Query:  147 FRSLMASGISVYIYSGDTDGTVPTISIRYSINKLGAKVKTAWYPCYIQ-GEXXXXXXXYQNLTFVTIRGAGHMVPSSQPARALAFFSSFLDGKLPP 431
            +R L+A+G+ ++++SGDTD  VP  + RYSI  LG    T+WYP Y    E       Y+ LT V++RGAGH VP  +P +AL  F  FL GK  P
Sbjct:  372 YRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALILFQQFLQGKPMP 467          

HSP 2 Score: 29.6462 bits (65), Expect = 1.332e-19
Identity = 10/26 (38.46%), Postives = 17/26 (65.38%), Query Frame = -3
Query:  421 WQDCSDAVLRHWKDSPLTVVGGIQEL 498
            W +CSD +  HW D+P +++   +EL
Sbjct:  350 WTNCSDTINTHWHDAPRSMLPIYREL 375          
The following BLAST results are available for this feature:
BLAST of DT214536 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
SCP40_ARATH1.737e-2346.46Serine carboxypeptidase-like 40 OS=Arabidopsis tha... [more]
SCP32_ARATH2.263e-2351.02Serine carboxypeptidase-like 32 OS=Arabidopsis tha... [more]
SCP24_ARATH6.486e-2347.37Serine carboxypeptidase 24 OS=Arabidopsis thaliana... [more]
SCP31_ARATH3.680e-2146.94Serine carboxypeptidase-like 31 OS=Arabidopsis tha... [more]
CBP2_WHEAT1.252e-2045.26Serine carboxypeptidase 2 OS=Triticum aestivum GN=... [more]
CBP21_HORVU4.686e-2045.26Serine carboxypeptidase II-1 (Fragment) OS=Hordeum... [more]
SCP30_ARATH6.940e-2047.25Putative serine carboxypeptidase-like 30 OS=Arabid... [more]
SCP26_ARATH7.880e-2043.16Serine carboxypeptidase-like 26 OS=Arabidopsis tha... [more]
SCP29_ARATH1.024e-1941.76Serine carboxypeptidase-like 29 OS=Arabidopsis tha... [more]
CBP2_HORVU1.332e-1944.79Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CB... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Developing Seed cDNA Library UCRCS09-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS09_16E08_b2 Ruby Orange Developing Seed cDNA Library UCRCS09-2 Citrus sinensis cDNA clone UCRCS09-16E08-I15-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214536 ID=DT214536|Name=DT214536|organism=Citrus sinensis|type=EST|length=518bp
TTTTACTTTCTTTTTGCTATTAAACATTGTCTGCTTTTGGTGATAATGTC
TAGCCGTTGACTAATGAACTAGGACAAAAGTTTAATAGTTTTGATTCAAA
CTAATTGCAATGATTCAATCTTATCCATTCTCTAGCTTTTTGCTGCGGGT
GGAAGCTTTCCATCTAAGAAGGATGAGAAGAAGGCAAGAGCCCGAGCAGG
TTGAGAACTTGGAACCATGTGTCCAGCACCTCTTATAGTCACAAATGTTA
GGTTCTGGTATCCCACAACATAACCACCAACCTCTCCTTGAATGTAACAA
GGGTACCAAGCTGTCTTTACTTTTGCTCCAAGTTTGTTTATTGAGTACCT
TATCGAAATCGTTGGCACCGTGCCATCAGTGTCTCCACTATAGATGTATA
CACTTATCCCGCTGGCCATTAAGCTCCTGAATGCCCCCCACGACTGTCAA
TGGACTGTCTTTCCAATGACGCAACACAGCGTCGCTGCAATCCTGCCATG
GACCTCGAATCCCCAGTA
back to top