DT214498

Overview
NameDT214498
Unique NameDT214498
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6524 contig Csv1_Contig6524:1..818. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214498 vs. ExPASy Swiss-Prot
Match: YZR3_ARATH (RanBP2-type zinc finger protein At1g67325 OS=Arabidopsis thaliana GN=At1g67325 PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 5.528e-47
Identity = 97/176 (55.11%), Postives = 110/176 (62.50%), Query Frame = -3
Query:  303 HYNYGSRLSAGSPYRPLHXXXXXXXXXXXXXXXXXXXXMPPPLMDRYXXXXXXXXXXXXXXXXXXP---DDKSQRKGADATRDNDWTCPKCGNINFSFRTVCNMRKCNTPKPGS-QAAKSDKNSKQKMPEGSWKCEKCNNINYPFRTKCNRQNCGADKPAE-SKKSLSPTTEENEQ 815
            H+NY SR+ AG+ YRPLH                    MPPP+ DRY                      D+KSQ++  D+TRDNDWTCP CGN+NFSFRTVCNMRKCNTPKPGS Q   SDK SKQ  PEGSWKC+ C NINYPFR+KCNRQNCGADKP + S  S S   EEN+Q
Sbjct:  116 HFNYNSRMPAGAHYRPLHMSGPPPYHGGSMMGSGGMYGMPPPI-DRYGLGMAMGPGSAAAMMPRPRFYPDEKSQKR--DSTRDNDWTCPNCGNVNFSFRTVCNMRKCNTPKPGSQQGGSSDKISKQNAPEGSWKCDNCGNINYPFRSKCNRQNCGADKPGDRSNGSPSRAPEENDQ 288          
The following BLAST results are available for this feature:
BLAST of DT214498 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
YZR3_ARATH5.528e-4755.11RanBP2-type zinc finger protein At1g67325 OS=Arabi... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_1E03_b2 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-2 Citrus sinensis cDNA clone UCRCS07-1E03-J5-1-7.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214498 ID=DT214498|Name=DT214498|organism=Citrus sinensis|type=EST|length=817bp
GGTAACAACTAGAACAGATGAGTTGATTTCCAAAAGTACAAAGCCTAACT
AATAGAAATCAGAACCAACCTGTAGAATCTTGCCAGAACAAGCTGGCTGA
CACTTTATGTATCAAAGGATCCATAAAGACCACAAATACCATCAAATTTA
ATACAACAAGTTGACACGAATCATGAGAAGGTAGAGTAATCGACAACCGC
TGCAACATGAGGACGACAAGACTGACTTTCAGACACCCATATTGAGCAAT
GCTGGAAGAAAACCCTGGACCTTCTCAACCCTCAAACATGTCCTAGTACT
CACTGCTCATTTTCTTCTGTAGTTGGTGAGAGAGACTTCTTTGACTCAGC
AGGTTTATCAGCTCCACAATTCTGTCTGTTGCATTTGGTCCTAAATGGGT
AGTTTATGTTGTTACATTTCTCACACTTCCAGCTACCCTCGGGCATCTTT
TGTTTTGAATTTTTGTCAGATTTCGCCGCCTGGGATCCAGGCTTTGGCGT
ATTACATTTCCTCATGTTACAAACAGTCCTAAAAGAAAAGTTGATATTTC
CACATTTTGGGCATGTCCAGTCATTATCACGTGTTGCATCTGCACCCTTT
CTCTGAGATTTGTCATCTGGGAAAAATCCAGGTCTTGGACCCATAGCAGC
AGGGCCCATTGGCAGACCTAAGCCATATCGGTCCATCAAGGGAGGTGGCA
TGCCATAAATTCCACCATTTCCCATCATAGAACCACCAGAATAAGGAGGT
GGTCCAGACATATGTAGCGGTCGGTAAGGGCTTCCAGCAGAAAGACGACT
TCCATAGTTGTAATGAT
back to top