DT214497

Overview
NameDT214497
Unique NameDT214497
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length775
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214497 vs. ExPASy Swiss-Prot
Match: BH092_ARATH (Transcription factor bHLH92 OS=Arabidopsis thaliana GN=BHLH92 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.638e-29
Identity = 78/176 (44.32%), Postives = 105/176 (59.66%), Query Frame = -1
Query:  110 KRMIQFLRKIQPAKMEHPELDSERGHRHVINXXXXXXXXRQNYLALHSILPPGTKNDKNSIVKTTANMIHELQCCKQELERKNYELESNLGLKNGG-----TKVRVNVDNPTSGVDSMLEVLKCLKDLGSSTRSIQAEFSDQKLTAVLDIETQMGAGAVEKDVQRALQKVEDKLLF 622
            KRM+  LRK    K      + ER  RH++         +Q+YLALHS+LP  TKNDKNSIV+   + I +LQ  K+EL R+   +E     K+G      TKVRVN+  P SG+DSMLE L  LK +G+  +++ A FS Q+ +A + IETQ+    VEK V+R LQ+ E KLLF
Sbjct:   63 KRMVNLLRKNWEEKKNTVAPEKERSRRHMLKERTRREKQKQSYLALHSLLPFATKNDKNSIVEKAVDEIAKLQRLKKELVRRIKVIEEK-SAKDGHDEMSETKVRVNLKEPLSGLDSMLEALHYLKSMGTKLKTVHANFSPQEFSATMTIETQIRGEEVEKRVERRLQETEWKLLF 237          
The following BLAST results are available for this feature:
BLAST of DT214497 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
BH092_ARATH1.638e-2944.32Transcription factor bHLH92 OS=Arabidopsis thalian... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_1B12_b2 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-2 Citrus sinensis cDNA clone UCRCS07-1B12-D23-1-7.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214497 ID=DT214497|Name=DT214497|organism=Citrus sinensis|type=EST|length=775bp
AGCCCATGCACTGCAAAGTATACATATAATTCGGTCAAAATTGTAACCTT
TGTGACGTCGAATTGCCACGTGCTTAGCCGCAAATATTCTAGCCTTCCTG
GTAGTGACGAAAAAGAAGCTTGTCTTCCACCTTTTGCAGTGCTCTCTGCA
CATCTTTTTCCACCGCGCCAGCTCCCATCTGAGTTTCAATATCCAGTACT
GCTGTCAGCTTCTGATCAGAAAACTCTGCTTGGATACTTCTCGTGCTCGA
GCCCAAATCCTTCAAGCATTTGAGAACCTCCAGCATTGAATCAACCCCAG
ATGTTGGATTATCTACATTTACTCTAACCTTTGTTCCCCCATTCTTCAGA
CCCAAATTCGATTCCAGCTCATAATTCTTCCTCTCCAATTCTTGCTTACA
GCATTGCAGCTCATGAATCATGTTCGCAGTTGTTTTAACAATCGAATTCT
TATCATTCTTGGTGCCAGGAGGCAAAATGGAATGCAGAGCTAAGTAATTT
TGCCTCTCCCTTTCTCTCCTCATTCGCTCGTTAATCACGTGCCTGTGACC
GCGCTCGCTGTCAAGTTCTGGGTGTTCCATTTTTGCAGGCTGAATCTTCC
TCAAGAATTGAATCATTCTCTTGTTCGCGCTTAAAGAATTAGACCCGTTA
CCAGCATTCTGCGACACAAATTCAGTTCTGGGTCTGTTTGCATATGCCAC
AAAAGCGCTTTGATTCACAGGAAGTGCTTCGTTGTCAAGCCAGAAGAAGA
TATCGCCCTCGCCATGAAATTGATC
back to top