DT214496

Overview
NameDT214496
Unique NameDT214496
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length360
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11035 contig Csv1_Contig11035:87..446. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214496 vs. ExPASy Swiss-Prot
Match: PP123_ARATH (Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.913e-14
Identity = 33/42 (78.57%), Postives = 38/42 (90.48%), Query Frame = -3
Query:  233 ELLHMFSFPFFAENGNSGCFVGCGEPLNKWLLQSYVDRMHLL 358
            ELL++F+FPFF ENGNSGCFVG GEPL  WLL+SYV+RMHLL
Sbjct:  814 ELLNIFNFPFFTENGNSGCFVGSGEPLKNWLLESYVERMHLL 855          
BLAST of DT214496 vs. ExPASy Swiss-Prot
Match: PPR49_ARATH (Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.619e-13
Identity = 32/42 (76.19%), Postives = 38/42 (90.48%), Query Frame = -3
Query:  233 ELLHMFSFPFFAENGNSGCFVGCGEPLNKWLLQSYVDRMHLL 358
            ELL++F  PFF E+GNSGCFVG GEPLN+WLLQS+V+RMHLL
Sbjct:  819 ELLNIFGSPFFTESGNSGCFVGSGEPLNRWLLQSHVERMHLL 860          
The following BLAST results are available for this feature:
BLAST of DT214496 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PP123_ARATH1.913e-1478.57Pentatricopeptide repeat-containing protein At1g74... [more]
PPR49_ARATH1.619e-1376.19Pentatricopeptide repeat-containing protein At1g18... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_18G10_b2 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-2 Citrus sinensis cDNA clone UCRCS07-18G10-N20-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214496 ID=DT214496|Name=DT214496|organism=Citrus sinensis|type=EST|length=360bp
TCTTTTTCGACATTTACAAATGGCTTAATGTTGAACCCCTTAAGGGGAAA
TGAAAGCTACAAGATGATGTAGCACGCACAATCAAAATCAGGCATTGTTT
TCGCATTTCAATGTGATTTAAAACTAGTTGCACAAAATTAGGTACAAAAT
GCACCGTACATCCGAACACCTCTTCTACTTCCCGCAACAAAACTCGGTTG
TGCTCATGCAGCTAAGTGCTGAATATCAACTATAGTAAATGCATCCGATC
CACATATGACTGGAGCAGCCATTTATTAAGAGGCTCCCCACACCCAACAA
AGCACCCAGAATTGCCATTCTCAGCGAAAAAAGGGAAGCTAAACATATGG
AGCAATTCCT
back to top