DT214494

Overview
NameDT214494
Unique NameDT214494
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length895
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6523 contig Csv1_Contig6523:1..895. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: YG41_SCHPO (Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe GN=SPBC23E6.01c PE=1 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 1.028e-36
Identity = 79/173 (45.66%), Postives = 108/173 (62.43%), Query Frame = -1
Query:  386 HETFASRYPSVKAAKVVFDANTGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPR-KXXXXXXXXXXXXXYASNG--APGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRN 895
            +  FASRY S K+AK++ D  T  S+GYGFVRF D+N++  A+ EM G  C  RP+R+G ATP+ K                 G  +  Q      D++N+T+FVGGL   V++E+L+  F  +GEI  VKIP GKGCGFVQF NR++AE A+++L G  +G   +RLSWGRN
Sbjct:  203 YSLFASRYNSCKSAKIMTDPQTNVSRGYGFVRFTDENDQKSALAEMQGQICGDRPIRVGLATPKSKAHVFSPVNVVPVSMPPVGFYSAAQPVPQFADTANSTVFVGGLSKFVSEEELKYLFQNFGEIVYVKIPPGKGCGFVQFVNRQSAEIAINQLQGYPLGNSRIRLSWGRN 375          
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: CSX1_SCHPO (RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe GN=csx1 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.176e-32
Identity = 71/170 (41.76%), Postives = 100/170 (58.82%), Query Frame = -1
Query:  386 TFASRYPSVKAAKVVFDANTGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATP--RKXXXXXXXXXXXXXYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRN 889
            TF S YPS  +AK++ D  TG S+ YGFVRF  + E+  A+  M G  C  RP+RI  A+P  R                SN  P Q   S  D  NTT+FVGGL  N++++DL+  F  +G I ++KIP GKGCGFVQ++ +  AE+A++ + G ++G   +RL+WG N
Sbjct:  201 TFRSIYPSCTSAKIIVDPVTGLSRKYGFVRFSSEKEQQHALMHMQGYLCQGRPLRISVASPKSRASIAADSALGIVPTSTSNRQPNQDLCSM-DPLNTTVFVGGLASNLSEKDLQVCFQPFGRILNIKIPFGKGCGFVQYSEKSAAEKAINTMQGALVGTSHIRLAWGHN 369          
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: NAM8_YEAST (Protein NAM8 OS=Saccharomyces cerevisiae GN=NAM8 PE=1 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 1.259e-26
Identity = 72/205 (35.12%), Postives = 103/205 (50.24%), Query Frame = -1
Query:  386 ETFASRYPSVKAAKVVFDANTGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKXXXXXXXXXXXXXYASNG--------APGQGPQSEG----------------------------DSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRN 892
            E F +RY S   AK+V D  TG SKGYGFV+F + +E+  A++EM GV+ + R +++G  + ++              + N         + GQ   S G                            D +NTT+F+GGL   VT+++LR  F  +G I  VKIPVGK CGFVQ+ +R +AE A+  + G  I    VRLSWGR+
Sbjct:  181 ELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRS 385          
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: TIAR_MOUSE (Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.925e-17
Identity = 56/183 (30.60%), Postives = 86/183 (46.99%), Query Frame = -1
Query:  341 YPSVKAAKVVFDANTGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKXXXXXXXXXXXXXYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPAN--KQF-RADYG--NQWS 874
            +  +  A+VV D  TG+SKGYGFV F +  +   A+  M G +   R +R   AT +                      Q         N T++ GG+   +TD+ +RQ FS +G+I  +++   KG  FV+F+  E+A  A+  +NGT I    V+  WG+   +  K F + DY    QWS
Sbjct:  137 FGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQS-----SPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWS 314          
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: TIAR_HUMAN (Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.925e-17
Identity = 56/183 (30.60%), Postives = 86/183 (46.99%), Query Frame = -1
Query:  341 YPSVKAAKVVFDANTGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKXXXXXXXXXXXXXYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPAN--KQF-RADYG--NQWS 874
            +  +  A+VV D  TG+SKGYGFV F +  +   A+  M G +   R +R   AT +                      Q         N T++ GG+   +TD+ +RQ FS +G+I  +++   KG  FV+F+  E+A  A+  +NGT I    V+  WG+   +  K F + DY    QWS
Sbjct:  120 FGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQS-----SPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWS 297          
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: TIA1_MOUSE (Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.925e-17
Identity = 52/176 (29.55%), Postives = 88/176 (50.00%), Query Frame = -1
Query:  356 VKAAKVVFDANTGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKXXXXXXXXXXXXXYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGR------NPANKQFRADY 865
            +  A+VV D  TG+SKGYGFV F +  +   A+ +M G +   R +R   AT +               + +        S+   +N T++ GG+   +T++ +RQ FS +G+I  +++   KG  FV+F++ E+A  A+  +NGT I    V+  WG+      NP  +Q +  Y
Sbjct:  132 ISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVV-----SQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGY 302          
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: TIA1_HUMAN (Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3)

HSP 1 Score: 87.8113 bits (216), Expect = 9.044e-17
Identity = 53/176 (30.11%), Postives = 86/176 (48.86%), Query Frame = -1
Query:  356 VKAAKVVFDANTGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKXXXXXXXXXXXXXYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGR------NPANKQFRADY 865
            +  A+VV D  TG+SKGYGFV F +  +   A+ +M G +   R +R   AT +               + +    Q        SN T++ GG+   +T++ +RQ FS +G+I  +++   KG  FV+F + E+A  A+  +NGT I    V+  WG+      NP  +Q +  Y
Sbjct:  132 ISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQS-----SPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGY 302          
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: NGR1_YEAST (Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae GN=NGR1 PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.706e-15
Identity = 38/76 (50.00%), Postives = 51/76 (67.11%), Query Frame = -1
Query:  389 DSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGR 616
            D +NTT+FVGGL P  T+  LR  F  +G I +V+IP GK CGFV+F  R +AE ++  L G ++G   +RLSWGR
Sbjct:  356 DPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWGR 431          
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: PABP_MAGGR (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe grisea GN=PAB1 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.201e-14
Identity = 49/160 (30.63%), Postives = 81/160 (50.62%), Query Frame = -1
Query:  434 HETFASRYPSVKAAKVVFDANTGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKXXXXXXXXXXXXXYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIP------VGKGCGFVQFANRENAEEALHKLN 895
            H+TFA+ + ++ + KV  D N G SKGYGFV +  D   SQA+  +NG+  + + + +G   P+K                     Q    E  ++ T I+V  ++P VTD++ R  F +YG++ S  +         +G GFV F + E+A +A+ +LN
Sbjct:  166 HDTFAA-FGNILSCKVAQDEN-GNSKGYGFVHYETDEAASQAIKHVNGMLLNEKKVYVGHHIPKKDR-------------------QSKFDEMKANFTNIYVKNINPEVTDDEFRTLFEKYGDVTSSSLARDQETGKSRGFGFVNFTSHEDASKAVQELN 304          
BLAST of DT214494 vs. ExPASy Swiss-Prot
Match: EPABB_XENLA (Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-B PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 7.166e-14
Identity = 50/157 (31.85%), Postives = 78/157 (49.68%), Query Frame = -1
Query:  422 SRYPSVKAAKVVFDANTGRSKGYGFVRFGDDNERSQAMTEMNGVYCSSRPMRIGAATPRKXXXXXXXXXXXXXYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPV----GKGCGFVQFANRENAEEALHKLNGTVI 880
            S + +  + KV+ D N+GRS+G+GFV +G+  E  +A+TEMNG   + R + +G A  R                      QG           ++V  LD  + D+ LR+ FS YG I S K+       KG GFV F++ E A +A+ ++NG ++
Sbjct:  212 SAFGNTLSVKVMMD-NSGRSRGFGFVNYGNHEEAQKAVTEMNGKEVNGRMVYVGRAQKRIERQGELKRKFEQIKQERINRYQG---------VNLYVKNLDDGIDDDRLRKEFSPYGTITSTKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNGRIV 358          
The following BLAST results are available for this feature:
BLAST of DT214494 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 57
Match NameE-valueIdentityDescription
YG41_SCHPO1.028e-3645.66Uncharacterized RNA-binding protein C23E6.01c OS=S... [more]
CSX1_SCHPO1.176e-3241.76RNA-binding post-transcriptional regulator csx1 OS... [more]
NAM8_YEAST1.259e-2635.12Protein NAM8 OS=Saccharomyces cerevisiae GN=NAM8 P... [more]
TIAR_MOUSE6.925e-1730.60Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=2 SV=... [more]
TIAR_HUMAN6.925e-1730.60Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=... [more]
TIA1_MOUSE6.925e-1729.55Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=... [more]
TIA1_HUMAN9.044e-1730.11Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=T... [more]
NGR1_YEAST1.706e-1550.00Negative growth regulatory protein NGR1 OS=Sacchar... [more]
PABP_MAGGR4.201e-1430.63Polyadenylate-binding protein, cytoplasmic and nuc... [more]
EPABB_XENLA7.166e-1431.85Embryonic polyadenylate-binding protein B OS=Xenop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_18F08_b2 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-2 Citrus sinensis cDNA clone UCRCS07-18F08-L16-1-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214494 ID=DT214494|Name=DT214494|organism=Citrus sinensis|type=EST|length=895bp
TTAGTTCTAGACAATAATAAATCCAATCCCTAGAAACTACCTCAGGTCGT
CATAATTCAATTCCGCTCCACAATGGACGGCATTTTATAAGAATTACTAC
AGAACCAAGAGACTACCGAAGATCAGGCACATTTGCCCTTTCTAGCGTGA
TAACGTTTAAATTTCTAGAGCTATACGTATTCTCTCCCGTGCAGTTACCT
CAGCTTACTTGTTGTTGGTGGCTGCCATACACAGGGTAAGCCCCATAGGC
CGCAGCTGCTGCAGCGTACATGCTTGGGTCATTTGGTGGCGGAATAGCAT
ACCCATAACCATCATAAACTTGCCCTCCATAGTATGCCCCACTCCATTGA
TTGCCATAATCTGCCCTAAACTGCTTATTTGCTGGGTTGCGCCCCCAAGA
AAGACGCACACTTTGCTTGCCAATTACTGTCCCATTCAACTTATGCAGTG
CTTCCTCAGCATTCTCTCTGTTGGCAAATTGTACGAATCCGCATCCTTTC
CCGACTGGTATTTTAACCGAGGCTATTTCGCCATACTGAGAGAAAGGTTG
TCGTAGATCTTCATCTGTGACATTAGGGTCAAGGCCACCAACAAATATTG
TTGTGTTTGAAGAGTCTCCTTCAGATTGAGGGCCTTGGCCTGGGGCACCA
TTTGACGCATACCCTCCTTGAGAAGAGTATTGCTGTTGATAACCAGAGGA
CTTCCTTGGAGTTGCAGCACCAATACGCATAGGCCTGCTTGAACAATAGA
CACCATTCATTTCAGTCATGGCCTGGGACCTCTCATTATCATCTCCAAAC
CTTACAAAACCATAACCTTTTGATCGACCAGTATTGGCATCAAAGACAAC
TTTTGCTGCTTTAACAGAAGGATATCTACTAGCAAAAGTTTCATG
back to top